Advanced Search (OLGA)

Gene: Umps (uridine monophosphate synthetase) Rattus norvegicus

Analyze

Symbol:

Umps

Name:

uridine monophosphate synthetase

RGD ID:

1311908

Description:

Enables orotate phosphoribosyltransferase activity and orotidine-5'-phosphate decarboxylase activity. Involved in several processes, including UMP biosynthetic process; female pregnancy; and lactation. Predicted to be located in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in orotic aciduria and purine-pyrimidine metabolic disorder. Orthologous to human UMPS (uridine monophosphate synthetase); PARTICIPATES IN beta-ureidopropionase deficiency pathway; de novo pyrimidine biosynthetic pathway; dihydropyrimidinase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC288051; uridine 5'-monophosphate synthase; uridine monophosphate synthase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UMPS (uridine monophosphate synthetase)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Umps (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Umps (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UMPS (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UMPS (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Umps (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UMPS (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UMPS (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Umps (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Umps (uridine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	UMPS (uridine monophosphate synthetase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Umps (uridine monophosphate synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	umps (uridine monophosphate synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	R12E2.11	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	r-l	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	r-l	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	URA3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	URA3	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	umps-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	umps-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	umps	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	umps	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	80,311,269 - 80,321,678 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	80,311,214 - 80,327,828 (+)	Ensembl				GRCr8
mRatBN7.2	11	66,806,107 - 66,816,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	66,806,045 - 66,821,903 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	75,639,569 - 75,649,990 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	68,301,455 - 68,311,876 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	67,332,029 - 67,342,450 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	70,034,181 - 70,044,590 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	70,034,139 - 70,044,628 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	73,123,827 - 73,134,236 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	68,619,835 - 68,630,244 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	66,256,748 - 66,267,157 (+)	NCBI		Celera
RGSC_v3.1	11	68,677,423 - 68,687,833 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

beta thalassemia (ISO)

Breast Neoplasms (ISO)

cardiomyopathy (ISO)

Colonic Neoplasms (ISO)

Colorectal Neoplasms (ISO)

congenital hypoplastic anemia (ISO)

erythroleukemia (ISO)

Experimental Diabetes Mellitus (IEP)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

hereditary spherocytosis (ISO)

Mouth Neoplasms (ISO)

orotic aciduria (ISO)

Orotic Aciduria II (ISO)

Prostatic Neoplasms (ISO)

purine-pyrimidine metabolic disorder (ISO)

sickle cell anemia (ISO)

squamous cell carcinoma (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-gambogic acid (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-fluorouracil (ISO)

acrylamide (EXP)

afimoxifene (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

azaribine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzoates (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dibenzofurans (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

glafenine (EXP)

GSK-J4 (ISO)

indometacin (EXP)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methotrexate (ISO)

mitomycin C (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel dichloride (ISO)

nimesulide (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pioglitazone (ISO)

progesterone (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

trovafloxacin (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

wogonin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' pyrimidine nucleobase biosynthetic process (IEA)

'de novo' UMP biosynthetic process (IEA,ISO)

cellular response to xenobiotic stimulus (IEP)

female pregnancy (IEP)

lactation (IEP)

pyrimidine nucleotide biosynthetic process (IEA)

UDP biosynthetic process (ISO)

UMP biosynthetic process (IDA,IEA,ISO)

Cellular Component

cytoplasm (ISO)

nucleus (ISO)

Molecular Function

carboxy-lyase activity (IEA)

catalytic activity (IEA)

glycosyltransferase activity (IEA)

identical protein binding (ISO)

lyase activity (IEA)

orotate phosphoribosyltransferase activity (IDA,IEA,ISO)

orotidine-5'-phosphate decarboxylase activity (IDA,IEA,ISO)

protein binding (ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-ureidopropionase deficiency pathway (ISO)

de novo pyrimidine biosynthetic pathway (ISO)

dihydropyrimidinase deficiency pathway (ISO)

mitochondrial neurogastrointestinal encephalopathy syndrome pathway (ISO)

orotic aciduria 1 pathway (ISO)

pyrimidine metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Mammalian pyrimidine biosynthesis: fresh insights into an ancient pathway.	Evans DR and Guy HI, J Biol Chem. 2004 Aug 6;279(32):33035-8. Epub 2004 Apr 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Pyrimidine nucleotide synthesis in the rat mammary gland: changes in the lactation cycle and effects of diabetes.	Kunjara S, etal., Biochem Med Metab Biol. 1992 Dec;48(3):263-74.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	Identification of new SNPs associated with severe toxicity to capecitabine.	Pellicer M, etal., Pharmacol Res. 2017 Jun;120:133-137. doi: 10.1016/j.phrs.2017.03.021. Epub 2017 Mar 27.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Molecular cloning of the human UMP synthase gene and characterization of point mutations in two hereditary orotic aciduria families.	Suchi M, etal., Am J Hum Genet. 1997 Mar;60(3):525-39.
14.	Increased levels of UMP synthase protein and mRNA in pyrazofurin-resistant rat hepatoma cells.	Suttle DP J Biol Chem. 1983 Jun 25;258(12):7707-13.
15.	Regulation of purine and pyrimidine metabolism by insulin and by resistance to tiazofurin.	Weber G, etal., Adv Enzyme Regul. 1985;23:81-99.

Additional References at PubMed

PMID:6893554	PMID:11730338	PMID:12477932	PMID:15890648	PMID:18184586

Genomics

Comparative Map Data

Umps
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	80,311,269 - 80,321,678 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	80,311,214 - 80,327,828 (+)	Ensembl				GRCr8
mRatBN7.2	11	66,806,107 - 66,816,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	66,806,045 - 66,821,903 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	75,639,569 - 75,649,990 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	68,301,455 - 68,311,876 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	67,332,029 - 67,342,450 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	70,034,181 - 70,044,590 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	70,034,139 - 70,044,628 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	73,123,827 - 73,134,236 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	68,619,835 - 68,630,244 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	66,256,748 - 66,267,157 (+)	NCBI		Celera
RGSC_v3.1	11	68,677,423 - 68,687,833 (+)	NCBI
Cytogenetic Map	11	q22	NCBI

UMPS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	124,730,452 - 124,749,273 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	124,730,433 - 124,749,273 (+)	Ensembl			hg38	GRCh38
GRCh37	3	124,449,299 - 124,468,120 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	125,931,903 - 125,946,318 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	125,931,902 - 125,946,318	NCBI
Celera	3	122,856,384 - 122,875,279 (+)	NCBI		Celera
Cytogenetic Map	3	q21.2	NCBI
HuRef	3	121,823,485 - 121,842,386 (+)	NCBI		HuRef
CHM1_1	3	124,412,201 - 124,431,088 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	127,456,263 - 127,475,096 (+)	NCBI		T2T-CHM13v2.0

Umps
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	33,775,152 - 33,787,408 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	33,775,152 - 33,787,408 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	33,954,782 - 33,967,038 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	33,954,782 - 33,967,038 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	33,955,098 - 33,967,089 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	33,874,759 - 33,886,750 (-)	NCBI		MGSCv36	mm8
Celera	16	34,439,142 - 34,451,132 (-)	NCBI		Celera
Cytogenetic Map	16	B3	NCBI
cM Map	16	24.26	NCBI

Umps
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	23,825,523 - 23,841,152 (+)	Ensembl
ChiLan1.0	NW_004955427	23,825,529 - 23,841,427 (+)	NCBI	ChiLan1.0	ChiLan1.0

UMPS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	122,691,417 - 122,706,258 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	122,696,194 - 122,711,035 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	121,832,758 - 121,851,707 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	128,731,309 - 128,745,241 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	128,731,355 - 128,745,029 (+)	Ensembl			panPan2	panpan1.1

UMPS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	27,754,592 - 27,782,517 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	27,754,643 - 27,782,514 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	27,778,349 - 27,806,263 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	27,991,347 - 28,019,249 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	27,991,386 - 28,019,245 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	27,786,637 - 27,814,528 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	27,830,936 - 27,858,855 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	28,449,678 - 28,477,605 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Umps
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	126,644,830 - 126,656,398 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936725	549,804 - 565,141 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936725	553,278 - 564,846 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UMPS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	135,610,058 - 135,650,603 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	135,611,857 - 135,650,656 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	145,113,405 - 145,154,901 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UMPS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	56,081,897 - 56,097,164 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	56,082,103 - 56,097,105 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	110,226,585 - 110,241,588 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Umps
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	761,210 - 779,321 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624731	761,235 - 780,355 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Umps
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	18,753,946 - 18,764,683 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Umps
17 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	84
Count of miRNA genes:	75
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000002450
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	73308487	96070872	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	79618519	99753367	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	73850894	99753367	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	73308315	99753367	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat

Markers in Region

AI044813

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,811,046 - 66,811,249 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	70,039,119 - 70,039,321	NCBI	Rnor6.0
Rnor_5.0	11	73,128,765 - 73,128,967	UniSTS	Rnor5.0
RGSC_v3.4	11	68,624,773 - 68,624,975	UniSTS	RGSC3.4
Celera	11	66,261,686 - 66,261,888	UniSTS
RH 3.4 Map	11	421.5	UniSTS
Cytogenetic Map	11	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002450 ⟹ ENSRNOP00000002450

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	80,311,214 - 80,321,677 (+)	Ensembl
mRatBN7.2 Ensembl	11	66,806,045 - 66,821,903 (+)	Ensembl
Rnor_6.0 Ensembl	11	70,034,139 - 70,044,628 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117390 ⟹ ENSRNOP00000085385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	80,311,251 - 80,323,865 (+)	Ensembl
mRatBN7.2 Ensembl	11	66,806,096 - 66,818,056 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000170202 ⟹ ENSRNOP00000111192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	80,311,251 - 80,327,828 (+)	Ensembl

RefSeq Acc Id:

NM_001025402 ⟹ NP_001020573

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,311,269 - 80,321,678 (+)	NCBI
mRatBN7.2	11	66,806,109 - 66,816,518 (+)	NCBI
Rnor_6.0	11	70,034,181 - 70,044,590 (+)	NCBI
Rnor_5.0	11	73,123,827 - 73,134,236 (+)	NCBI
RGSC_v3.4	11	68,619,835 - 68,630,244 (+)	RGD
Celera	11	66,256,748 - 66,267,157 (+)	RGD

Sequence:

show sequence

GGATGGAGGTCGCCCGCCAAGCCCTGGGCCCCTTGGTCACCGAGCTGTATGACGTGCAGGCTTT
CAAGTTCGGGAGCTTCGTGCTGAAGAGCGGGCTCTCCTCCCCAGTCTACATCGACCTGCGGGGC
ATCGTGTCACGCCCGCGTCTTCTCAGTCAGGTCGCAGACATTTTATTCCAAACTGCCAGGAATG
CCGGGATCAGTTTTGACAGTGTGTGTGGAGTTCCTTATACAGCGTTACCACTAGCAACAGTTAT
CTGTTCAGCCAATCATATTCCCATGCTCATTAGGAGGAAGGAAACAAAGGATTATGGTACTAAG
CGCCTTGTAGAAGGAGAGATTAATCCGGGGCAGACCTGTCTGGTCATCGAGGATGTCGTCACCA
GTGGGGCCAGCGTTTTGGAGACTGTTGAAGTTCTTCAGAAGGAGGGTCTAAAGGTGACTGATGC
CATCGTGCTGTTGGACCGCGAGCAGGGAGGCAAGGACAAGCTGCAGGCTCAGGGCATCCGTCTC
CACTCTGTGTGCACGTTGTCGGAAATGCTGGAGATCCTTGAGCAGCAGAAAAAGATCGACGCTG
AGATGGTCGGGAGAGTGAAGAGGTTCATTCAGGAGAATGTGTTCACAGCAGCTAACCATAATGG
CGTTCCCCCTCCCGAGAAGAAAGCATGCAAGGAACTGAGCTTTGGCGCCCGAGCAGAGCTGCCT
GGAGTCCACCCACTTGCCTCAAAGCTTCTCACGCTCATGCAGAAGAAGGAGACCAATCTGTGTC
TGTCTGCTGACGTGTCGGAGGCCAGAGAGCTGCTGCAGCTAGCCGATGCCCTAGGACCCAGCAT
CTGCATGCTCAAAACTCATGTCGATATTCTGAACGATTTTACTCTGGATGTGATGGAGGAGTTG
ACAACCCTGGCAAAACGCCATGAGTTTTTAATATTTGAAGACAGGAAATTTGCTGATATAGGAA
ACACAGTTAAAAAGCAGTATGAAAGTGGCATCTTTAAAATAGCTTCCTGGGCAGACGTAGTGAA
TGCCCATGTGGTGCCAGGCTCAGGAGTTGTGAAGGGCTTACAGGAAGTGGGTCTGCCTTTACAT
CGAGCCTGCCTGCTCATTGCAGAAATGAGCTCTGCTGGCTCCTTGGCCACTGGAGACTACACCA
AAGCAGCAGTTGGGATGGCTGAGGAGCACTGTGAGTTTGTCATTGGCTTTATTTCTGGCTCCCG
AGTAAGCATGAAACCGGAGTTTCTTCACTTGACCCCAGGAGTTCAGTTAGAGACAGGAGGGGAT
CACCTTGGCCAGCAGTACAATAGTCCCCAAGAAGTGGTTGGTAAACGAGGTTCTGATGTCATCA
TTGTGGGCCGGGGAATACTCGCAGCAGCAAACCGCCTGGAAGCAGCTGAGATGTACAGAAAAGC
TGCCTGGGAAGCTTATTTGAGTAGGCTTGCTGTCCAGTGAGAAGGCACTGAACGTGGGTGGTAG
CCCAAAGTCGCTGGCTTCAAAGAACAGTGCTCAGGGTCCTGCACAGGGTTTGTGAGAGACAGAC
TCTGCAGCACCGTGTTGTGTCTTTAACTTGTAACCACTGCACTGTACTATAACGAGCTCTTTAA
AGCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020573	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98033	(Get FASTA)	NCBI Sequence Viewer
	EDM11351	(Get FASTA)	NCBI Sequence Viewer
	EDM11352	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002450.7
	ENSRNOP00000085385
	ENSRNOP00000085385.1
	ENSRNOP00000111192.1

RefSeq Acc Id:

NP_001020573 ⟸ NM_001025402

- UniProtKB:

Q4QQS7 (UniProtKB/TrEMBL), A6IRJ8 (UniProtKB/TrEMBL), F7FPV0 (UniProtKB/TrEMBL), A0A8I6A354 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVARQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQTARNA
GISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCLVIEDVVTS
GASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHSVCTLSEMLEILEQQKKIDAE
MVGRVKRFIQENVFTAANHNGVPPPEKKACKELSFGARAELPGVHPLASKLLTLMQKKETNLCL
SADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTTLAKRHEFLIFEDRKFADIGN
TVKKQYESGIFKIASWADVVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMSSAGSLATGDYTK
AAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVVGKRGSDVII
VGRGILAAANRLEAAEMYRKAAWEAYLSRLAVQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000002450 ⟸ ENSRNOT00000002450

Ensembl Acc Id:

ENSRNOP00000085385 ⟸ ENSRNOT00000117390

Ensembl Acc Id:

ENSRNOP00000111192 ⟸ ENSRNOT00000170202

Protein Domains

Orotidine 5'-phosphate decarboxylase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQS7-F1-model_v2	AlphaFold	Q4QQS7	1-481	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698196

Promoter ID:

EPDNEW_R8721

Type:

initiation region

Name:

Umps_1

Description:

uridine monophosphate synthetase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	70,034,161 - 70,034,221	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311908	AgrOrtholog
BioCyc Gene	G2FUF-21136	BioCyc
Ensembl Genes	ENSRNOG00000001797	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002450.8	UniProtKB/TrEMBL
	ENSRNOT00000117390	ENTREZGENE
	ENSRNOT00000117390.2	UniProtKB/TrEMBL
	ENSRNOT00000170202.1	UniProtKB/TrEMBL
Gene3D-CATH	3.20.20.70	UniProtKB/TrEMBL
	3.40.50.2020	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7456468	IMAGE-MGC_LOAD
InterPro	Aldolase_TIM	UniProtKB/TrEMBL
	OMPdecase_1_core	UniProtKB/TrEMBL
	OMPdecase_AS	UniProtKB/TrEMBL
	OMPdecase_core	UniProtKB/TrEMBL
	Or_phspho_trans	UniProtKB/TrEMBL
	Orotate_PribosylTferase	UniProtKB/TrEMBL
	PRibTrfase	UniProtKB/TrEMBL
	PRTase-like	UniProtKB/TrEMBL
	RibuloseP-bd_barrel	UniProtKB/TrEMBL
KEGG Report	rno:288051	UniProtKB/TrEMBL
MGC_CLONE	MGC:116188	IMAGE-MGC_LOAD
NCBI Gene	288051	ENTREZGENE
PANTHER	OROTATE PHOSPHORIBOSYLTRANSFERASE	UniProtKB/TrEMBL
	URIDINE 5'-MONOPHOSPHATE SYNTHASE	UniProtKB/TrEMBL
Pfam	OMPdecase	UniProtKB/TrEMBL
	Pribosyltran	UniProtKB/TrEMBL
PharmGKB	UMPS	RGD
PhenoGen	Umps	PhenoGen
PROSITE	OMPDECASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001797	RatGTEx
SMART	OMPdecase	UniProtKB/TrEMBL
Superfamily-SCOP	RibP_bind_barrel	UniProtKB/TrEMBL
	SSF53271	UniProtKB/TrEMBL
UniProt	A0A8I6A354	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0M2N2_RAT	UniProtKB/TrEMBL
	A6IRJ8	ENTREZGENE, UniProtKB/TrEMBL
	A6IRJ9_RAT	UniProtKB/TrEMBL
	F7FPV0	ENTREZGENE, UniProtKB/TrEMBL
	Q4QQS7	ENTREZGENE
UniProt Secondary	Q4QQS7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Umps	uridine monophosphate synthetase	Umps_predicted	uridine monophosphate synthetase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Umps_predicted	uridine monophosphate synthetase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)