Advanced Search (OLGA)

Gene: Taf6 (TATA-box binding protein associated factor 6) Rattus norvegicus

Analyze

Symbol:

Taf6

Name:

TATA-box binding protein associated factor 6

RGD ID:

1311608

Description:

Predicted to enable DNA binding activity; aryl hydrocarbon receptor binding activity; and transcription coactivator activity. Predicted to contribute to RNA polymerase II general transcription initiation factor activity. Predicted to be involved in several processes, including positive regulation of intrinsic apoptotic signaling pathway; positive regulation of transcription initiation by RNA polymerase II; and transcription by RNA polymerase II. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of MLL1 complex; transcription factor TFIID complex; and transcription factor TFTC complex. Predicted to be active in nucleus. Orthologous to human TAF6 (TATA-box binding protein associated factor 6); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC288533; MGC112914; p80; TAF(II)70; TAF(II)80; TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80 kDa; TAFII-70; TAFII-80; TAFII70; TAFII80; TFIID subunit p80; transcription initiation factor TFIID 70 kDa subunit; transcription initiation factor TFIID 80 kDa subunit; transcription initiation factor TFIID subunit 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAF6 (TATA-box binding protein associated factor 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Taf6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Taf6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TAF6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAF6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Taf6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAF6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TAF6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Taf6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Taf6 (TATA-box binding protein associated factor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TAF6 (TATA-box binding protein associated factor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TAF6 (TATA-box binding protein associated factor 6)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Taf6 (TATA-box binding protein associated factor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	taf6 (TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Taf6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TAF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TAF6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	taf-6.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	taf-6.2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	mia	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	taf6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	taf6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,169,570 - 22,178,031 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,168,718 - 22,177,938 (-)	Ensembl				GRCr8
mRatBN7.2	12	17,055,864 - 17,064,244 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	17,055,873 - 17,064,247 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	17,879,229 - 17,887,596 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	18,502,973 - 18,511,340 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	17,556,379 - 17,564,746 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	19,320,269 - 19,328,706 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,320,271 - 19,328,637 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,377,899 - 21,386,267 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,620,900 - 17,629,268 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	18,986,031 - 18,994,399 (-)	NCBI		Celera
RGSC_v3.1	12	17,610,570 - 17,618,803 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alazami-Yuan Syndrome (ISO)

Cornelia de Lange syndrome 1 (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

syndromic intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

acetylsalicylic acid (ISO)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gallic acid (ISO)

ivermectin (ISO)

ozone (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

tamoxifen (ISO)

thapsigargin (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA-templated transcription (IEA)

DNA-templated transcription initiation (IEA,ISO)

mRNA transcription by RNA polymerase II (IEA,ISO)

negative regulation of cell cycle (IEA,ISO)

negative regulation of cell population proliferation (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of intrinsic apoptotic signaling pathway (ISO)

positive regulation of transcription initiation by RNA polymerase II (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA,ISO)

RNA polymerase II preinitiation complex assembly (IBA,IEA,ISO)

transcription initiation at RNA polymerase II promoter (IEA,ISO)

Cellular Component

MLL1 complex (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

protein-containing complex (IEA,ISO)

SAGA complex (IEA)

SLIK (SAGA-like) complex (IEA)

transcription factor TFIID complex (IBA,IEA,ISO)

transcription factor TFTC complex (IEA,ISO)

Molecular Function

aryl hydrocarbon receptor binding (IEA,ISO)

DNA binding (IEA,ISO)

protein binding (ISO)

protein heterodimerization activity (IEA)

RNA polymerase II general transcription initiation factor activity (IBA,IEA,ISO)

transcription coactivator activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Structural bioinformatics of the general transcription factor TFIID.	Malkowska M, etal., Biochimie. 2013 Apr;95(4):680-91. doi: 10.1016/j.biochi.2012.10.024. Epub 2012 Nov 9.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:7665101	PMID:8262073	PMID:9603525	PMID:11583621	PMID:12477932	PMID:12665565	PMID:14580349	PMID:15328371	PMID:15601843	PMID:15641800	PMID:15960975	PMID:17242199
PMID:18628956	PMID:18722179	PMID:20096117	PMID:22323595	PMID:22871113	PMID:27007846

Genomics

Comparative Map Data

Taf6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,169,570 - 22,178,031 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	22,168,718 - 22,177,938 (-)	Ensembl				GRCr8
mRatBN7.2	12	17,055,864 - 17,064,244 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	17,055,873 - 17,064,247 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	17,879,229 - 17,887,596 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	18,502,973 - 18,511,340 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	17,556,379 - 17,564,746 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	19,320,269 - 19,328,706 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,320,271 - 19,328,637 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	21,377,899 - 21,386,267 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	17,620,900 - 17,629,268 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	18,986,031 - 18,994,399 (-)	NCBI		Celera
RGSC_v3.1	12	17,610,570 - 17,618,803 (-)	NCBI
Cytogenetic Map	12	q11	NCBI

TAF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	100,107,070 - 100,127,171 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	100,106,876 - 100,120,091 (-)	Ensembl			hg38	GRCh38
GRCh37	7	99,704,693 - 99,717,481 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	99,542,629 - 99,554,915 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	99,349,344 - 99,361,630	NCBI
Celera	7	94,439,352 - 94,452,642 (-)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	94,340,345 - 94,353,117 (-)	NCBI		HuRef
CHM1_1	7	99,634,850 - 99,647,636 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	101,346,916 - 101,367,060 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	99,064,811 - 99,077,600 (-)	NCBI

Taf6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	138,176,879 - 138,185,713 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	138,176,879 - 138,185,713 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	138,178,617 - 138,187,451 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	138,178,617 - 138,187,451 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	138,619,845 - 138,628,414 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	138,408,405 - 138,416,974 (-)	NCBI		MGSCv36	mm8
Celera	5	135,157,925 - 135,166,486 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.98	NCBI

Taf6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955573	752,601 - 759,292 (+)	Ensembl
ChiLan1.0	NW_004955573	752,646 - 759,292 (+)	NCBI	ChiLan1.0	ChiLan1.0

TAF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	118,026,867 - 118,038,405 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	166,291,492 - 166,303,766 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	92,142,646 - 92,154,951 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	105,575,861 - 105,588,177 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	105,575,861 - 105,588,142 (-)	Ensembl			panPan2	panpan1.1

TAF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	9,475,132 - 9,488,611 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	9,479,884 - 9,488,561 (+)	Ensembl			canFam3	CanFam3.1
ROS_Cfam_1.0	6	9,412,120 - 9,425,610 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	9,416,894 - 9,425,608 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	9,261,440 - 9,274,922 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	9,241,761 - 9,255,245 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	9,421,342 - 9,434,833 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Taf6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	133,779,962 - 133,786,349 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	247,096 - 256,629 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	250,174 - 256,405 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	8,017,675 - 8,026,888 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	8,017,675 - 8,026,982 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TAF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	12,958,555 - 12,971,100 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	12,963,609 - 12,973,368 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	3,301,791 - 3,314,542 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Taf6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	16,877,619 - 16,883,742 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	16,877,535 - 16,883,742 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Taf6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	15,550,517 - 15,556,246 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Taf6
73 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	20
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000001829
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

BI301666

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	17,062,714 - 17,062,900 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	19,327,114 - 19,327,298	NCBI	Rnor6.0
Rnor_5.0	12	21,384,744 - 21,384,928	UniSTS	Rnor5.0
RGSC_v3.4	12	17,627,745 - 17,627,929	UniSTS	RGSC3.4
Celera	12	18,992,876 - 18,993,060	UniSTS
RH 3.4 Map	12	254.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

BF406289

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	17,057,206 - 17,057,321 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	19,321,610 - 19,321,724	NCBI	Rnor6.0
Rnor_5.0	12	21,379,240 - 21,379,354	UniSTS	Rnor5.0
RGSC_v3.4	12	17,622,241 - 17,622,355	UniSTS	RGSC3.4
Celera	12	18,987,372 - 18,987,486	UniSTS
RH 3.4 Map	12	254.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

RH137179

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	17,055,973 - 17,056,154 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	19,320,378 - 19,320,558	NCBI	Rnor6.0
Rnor_5.0	12	21,378,008 - 21,378,188	UniSTS	Rnor5.0
RGSC_v3.4	12	17,621,009 - 17,621,189	UniSTS	RGSC3.4
Celera	12	18,986,140 - 18,986,320	UniSTS
RH 3.4 Map	12	255.4	UniSTS
Cytogenetic Map	12	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001044225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001436464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC100108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D49446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001829 ⟹ ENSRNOP00000001829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	22,168,718 - 22,177,938 (-)	Ensembl
mRatBN7.2 Ensembl	12	17,055,873 - 17,064,247 (-)	Ensembl
Rnor_6.0 Ensembl	12	19,320,271 - 19,328,637 (-)	Ensembl

RefSeq Acc Id:

NM_001044225 ⟹ NP_001037690

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,169,570 - 22,177,938 (-)	NCBI
mRatBN7.2	12	17,055,864 - 17,064,244 (-)	NCBI
Rnor_6.0	12	19,320,269 - 19,328,637 (-)	NCBI
Rnor_5.0	12	21,377,899 - 21,386,267 (-)	NCBI
RGSC_v3.4	12	17,620,900 - 17,629,268 (-)	RGD
Celera	12	18,986,031 - 18,994,399 (-)	RGD

Sequence:

show sequence

GGCGCCGAGCGCCGGGTGAGCGGCGCCTTGGCAGCGGATCTCCATCTCTCCACCCTGGGGTGAC
ATCCTTCCAGGGACAGGAGCTGGAACTCCAGCATGGCTGAGGAGAAGAAACTGAAACTCAGCAA
TACCGTGTTGCCCTCCGAGTCTATGAAGGTGGTGGCAGAATCCATGGGCATTGCTCAGATTCAG
GAGGAGACTTGCCAGCTACTGACAGATGAGGTCAGCTACCGCATCAAGGAGATTGCCCAGGATG
CTTTGAAGTTCATGCACATGGGGAAACGACAGAAGCTCACTACCAGTGACATTGACTATGCATT
GAAATTAAAGAATGTGGAGCCACTATATGGCTTCCATGCTCAGGAGTTCATCCCTTTCCGGTTT
GCCTCTGGTGGGGGCCGGGAGCTGTACTTCTATGAAGAGAAGGAAGTGGACCTGAGTGATATCA
TCAACACCCCTCTGCCTCGGGTGCCTCTGGATGTCTGCCTCAAAGCTCATTGGCTGAGCATTGA
AGGCTGCCAGCCAGCTATACCAGAGAATCCACCCCCAGCTCCCAAAGAGCAGCAGAAGGCCGAG
GCCACAGAACCCCTGAAGTCAGCAAAGCCAGGCCAAGAAGAAGATGGACCCTTGAAAGGCAAAG
GTCAAGGGGCAGCTGCAGCTGATGGCAAAGGAAAAGAGAAGAAGGCACCTCCCTTGCTGGAAGG
GGCCCCTTTCCGCCTGAAGCCCCGCAGCATCCATGAGCTGTCCGTGGAGCAGCAGCTGTACTAC
AAGGAGATCACAGAAGCCTGTGTGGGATCCTGTGAGGCCAAGAGAGCGGAAGCTCTGCAGAGCA
TTGCCACAGATCCTGGACTCTATCAGATGTTACCACGGTTTAGTACCTTCATCTCAGAGGGGGT
CCGTGTGAATGTGGTTCAGAATAACCTGGCCTTGCTCATCTACTTGATGCGAATGGTTAAGGCC
CTGATGGACAACCCCACACTGTATCTTGAGAAATATGTGCACGAGCTGATTCCTGCAGTAATGA
CCTGCATTGTGAGCAGACAGCTGTGCCTGCGGCCAGATGTGGACAATCACTGGGCACTCCGGGA
TTTTGCTGCCCGTCTAGTGGCCCAGATCTGTAAGCATTTCAGCACAACCACCAACAACATCCAA
TCCCGAATCACCAAGACCTTTACCAAGAGCTGGGTGGATGAGAAGACTCCATGGACAACTCGAT
ATGGCTCCATTGCAGGCCTGGCAGAGCTGGGGCATGATGTGATTAAGACCCTAATTCTGCCAAG
GCTGCAGCAGGAAGGGGAGCGGATCCGAAGTGTCTTGGACGGACCTGTTCTGAGCAACATCGAC
CGTATCGGAGCAGACCATGTTCAGAGCCTTCTCCTGAAACACTGTGCCCCAGTATTGGCGAAGC
TGCGCCCTCCACCTGACAATCAGGATGCCTACCGGGGAGAATTTGGGTCCCTTGGGCCCCTTCT
CTGCTCCCATGTGGTGAAGGCCAGGGCCCAGGCCGCTCTTCAAGCTCAGCAGGTCAACAGGACC
ACACTCACCATCACACAGCCTCGGCCCACACTGACCCTCTCACAGGCCCCTCAGCCAGGCCCTC
GTACCCCTGGCTTATTGAAGGTCCCTGGCTCTATTGCCTTGCCTGTCCAGACACTGGTGTCTGC
AAGAGCTGCTGCCCCTCCTCAGCCTTCTCCTCCTCCAACGAAGTTTATTGTAATGTCCTCATCT
TCCAGTGCCTCATCAACCCAGCAGGGGAAGGCAAAGGAGGCCCTCCTTCTCATCCTTCTCCAGT
CCCACCTTCATCTTCTTCACCATCTCCACTTGGGGGCAGTGCCCTCTGTGGGGGGAAGCAGGAA
ACTGGGGACAGCCCCCCTCCAGCTCCAGGGACTCCAAAGGCTAATGGCTCCCAGCCTACTGGAC
CTAGCTCTCCCCAGCCTGCTCTGTGATATTGTCACATGTGCTGACCTCCTCTCTTCTGCAGATT
CCTACACACACAAACAACGTGTGAGGGAGGAAGAAGAAAGATGTTTTCCCCAGTGACTTTCTTT
TTAGATTCTGTACAGTAAGTTCCTCAGAATAAAAGTTGGATTTGTAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271144 ⟹ XP_063127214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,169,570 - 22,178,031 (-)	NCBI

RefSeq Acc Id:

XM_063271145 ⟹ XP_063127215

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,169,570 - 22,177,960 (-)	NCBI

RefSeq Acc Id:

XM_063271146 ⟹ XP_063127216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	22,169,570 - 22,177,951 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001037690	(Get FASTA)	NCBI Sequence Viewer
	NP_001423393	(Get FASTA)	NCBI Sequence Viewer
	XP_063127214	(Get FASTA)	NCBI Sequence Viewer
	XP_063127215	(Get FASTA)	NCBI Sequence Viewer
	XP_063127216	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00109	(Get FASTA)	NCBI Sequence Viewer
	BAA08435	(Get FASTA)	NCBI Sequence Viewer
	EDL83898	(Get FASTA)	NCBI Sequence Viewer
	EDL83899	(Get FASTA)	NCBI Sequence Viewer
	EDL83900	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001829
GenBank Protein	Q63801	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001037690 ⟸ NM_001044225

- UniProtKB:

Q498R0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQ
KLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLD
VCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGAAAADGKG
KEKKAPPLLEGAPFRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQML
PRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELG
HDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAY
RGEFGSLGPLLCSHVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGS
IALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSASSTQQGKAKEALLLILLQSHLHLLHHLHL
GAVPSVGGSRKLGTAPLQLQGLQRLMAPSLLDLALPSLLCDIVTCADLLSSADSYTHKQRVREE
EERCFPQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000001829 ⟸ ENSRNOT00000001829

RefSeq Acc Id:	XP_063127214 ⟸ XM_063271144
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063127215 ⟸ XM_063271145
- Peptide Label:	isoform X1
- UniProtKB:	Q63801 (UniProtKB/Swiss-Prot), A6KST3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063127216 ⟸ XM_063271146
- Peptide Label:	isoform X1
- UniProtKB:	Q63801 (UniProtKB/Swiss-Prot), A6KST3 (UniProtKB/TrEMBL)

Protein Domains

TATA box binding protein associated factor (TAF)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63801-F1-model_v2	AlphaFold	Q63801	1-678	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698495

Promoter ID:

EPDNEW_R9020

Type:

multiple initiation site

Name:

Taf6_1

Description:

TATA-box binding protein associated factor 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	19,328,648 - 19,328,708	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311608	AgrOrtholog
BioCyc Gene	G2FUF-19807	BioCyc
Ensembl Genes	ENSRNOG00000001355	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000001829	ENTREZGENE
Gene3D-CATH	1.10.20.10	UniProtKB/Swiss-Prot
	1.25.40.770	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7379862	IMAGE-MGC_LOAD
InterPro	ARM-type_fold	UniProtKB/Swiss-Prot
	Histone-fold	UniProtKB/Swiss-Prot
	TAF6	UniProtKB/Swiss-Prot
	TAF6_C	UniProtKB/Swiss-Prot
	TAF6_C_sf	UniProtKB/Swiss-Prot
	TAF_TATA-bd	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112914	IMAGE-MGC_LOAD
NCBI Gene	288533	ENTREZGENE
PANTHER	PTHR10221	UniProtKB/Swiss-Prot
	TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 6	UniProtKB/Swiss-Prot
Pfam	TAF	UniProtKB/Swiss-Prot
	TAF6_C	UniProtKB/Swiss-Prot
PhenoGen	Taf6	PhenoGen
RatGTEx	ENSRNOG00000001355	RatGTEx
SMART	TAF	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47113	UniProtKB/Swiss-Prot
	SSF48371	UniProtKB/Swiss-Prot
UniProt	A0A0H2UH98_RAT	UniProtKB/TrEMBL
	A6KST3	ENTREZGENE, UniProtKB/TrEMBL
	Q498R0	ENTREZGENE, UniProtKB/TrEMBL
	Q63801	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Taf6	TATA-box binding protein associated factor 6	Taf6	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Taf6	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor	Taf6_predicted	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Taf6_predicted	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations