Advanced Search (OLGA)

Gene: Trappc1 (trafficking protein particle complex subunit 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Trappc1

Name:

trafficking protein particle complex subunit 1

RGD ID:

1311365

Description:

Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport. Predicted to be located in Golgi apparatus and endoplasmic reticulum. Predicted to be part of TRAPP complex. Orthologous to human TRAPPC1 (trafficking protein particle complex subunit 1); INTERACTS WITH (+)-schisandrin B; 2,4,6-trinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC287427; trafficking protein particle complex 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRAPPC1 (trafficking protein particle complex subunit 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Trappc1 (trafficking protein particle complex 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trappc1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRAPPC1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRAPPC1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trappc1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRAPPC1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRAPPC1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trappc1 (trafficking protein particle complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TRAPPC1 (trafficking protein particle complex subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trappc1 (trafficking protein particle complex 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trappc1 (trafficking protein particle complex 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Bet5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BET5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	trpp-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	trappc1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,544,406 - 54,545,992 (+)	NCBI		GRCr8
mRatBN7.2	10	54,045,598 - 54,047,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,045,537 - 54,047,331 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,707,276 - 58,708,862 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,195,890 - 58,197,476 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,704,035 - 53,705,621 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,924,996 - 55,926,582 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,924,938 - 55,926,783 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,667,071 - 55,668,657 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,117,229 - 56,118,815 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,130,805 - 56,132,585 (+)	NCBI
Celera	10	53,202,167 - 53,203,753 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trappc1	Rat	common variable immunodeficiency		ISO	TRAPPC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Common variable immunodeficiency	ClinVar	PMID:28492532
Trappc1	Rat	Diamond-Blackfan anemia		ISO	TRAPPC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Diamond-Blackfan anemia	ClinVar	PMID:20522432 more ...
Trappc1	Rat	dyskeratosis congenita		ISO	TRAPPC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita	ClinVar	PMID:20522432 more ...
Trappc1	Rat	Li-Fraumeni syndrome		ISO	TRAPPC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Li-Fraumeni syndrome	ClinVar	PMID:20522432 more ...
Trappc1	Rat	very long chain acyl-CoA dehydrogenase deficiency		ISO	TRAPPC1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Very long chain acyl-CoA dehydrogenase deficiency	ClinVar	PMID:11590124 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trappc1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TRAPPC1 mRNA]	CTD	PMID:31150632
Trappc1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Trappc1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:22206623
Trappc1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Trappc1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TRAPPC1 mRNA	CTD	PMID:21570461
Trappc1	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of TRAPPC1 mRNA	CTD	PMID:21346803
Trappc1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TRAPPC1 mRNA	CTD	PMID:28628672
Trappc1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Trappc1 (Mus musculus)	6480464	bisphenol S results in increased expression of TRAPPC1 mRNA	CTD	PMID:39298647
Trappc1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of TRAPPC1 mRNA	CTD	PMID:28959563
Trappc1	Rat	arsane	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TRAPPC1 mRNA	CTD	PMID:39836092
Trappc1	Rat	arsenic atom	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TRAPPC1 mRNA	CTD	PMID:39836092
Trappc1	Rat	benzo[a]pyrene	increases expression	ISO	Trappc1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TRAPPC1 mRNA	CTD	PMID:21715664 and PMID:22228805
Trappc1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20018196
Trappc1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of TRAPPC1 mRNA	CTD	PMID:25181051
Trappc1	Rat	bisphenol F	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TRAPPC1 mRNA	CTD	PMID:28628672
Trappc1	Rat	cadmium atom	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRAPPC1 mRNA	CTD	PMID:35301059
Trappc1	Rat	cadmium dichloride	increases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of TRAPPC1 mRNA	CTD	PMID:38382870
Trappc1	Rat	cadmium dichloride	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TRAPPC1 mRNA	CTD	PMID:35301059
Trappc1	Rat	carbon nanotube	increases expression	ISO	Trappc1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Trappc1	Rat	cyclosporin A	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of TRAPPC1 mRNA	CTD	PMID:20106945 and PMID:25562108
Trappc1	Rat	cyclosporin A	decreases methylation	ISO	TRAPPC1 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of TRAPPC1 promoter	CTD	PMID:27989131
Trappc1	Rat	dexamethasone	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TRAPPC1 mRNA	CTD	PMID:28628672
Trappc1	Rat	Dibutyl phosphate	affects expression	ISO	TRAPPC1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of TRAPPC1 mRNA	CTD	PMID:37042841
Trappc1	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of TRAPPC1 mRNA	CTD	PMID:21551480
Trappc1	Rat	doxorubicin	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of TRAPPC1 mRNA	CTD	PMID:29803840
Trappc1	Rat	fluoranthene	multiple interactions	ISO	Trappc1 (Mus musculus)	6480464	[1-methylanthracene co-treated with fluoranthene] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:28329830
Trappc1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of TRAPPC1 mRNA	CTD	PMID:24136188
Trappc1	Rat	folic acid	multiple interactions	ISO	Trappc1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:22206623
Trappc1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of TRAPPC1 mRNA	CTD	PMID:33387578
Trappc1	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of TRAPPC1 mRNA	CTD	PMID:24136188
Trappc1	Rat	indometacin	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TRAPPC1 mRNA	CTD	PMID:28628672
Trappc1	Rat	ivermectin	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of TRAPPC1 protein	CTD	PMID:32959892
Trappc1	Rat	lipopolysaccharide	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of TRAPPC1 mRNA	CTD	PMID:35877022
Trappc1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:25729387
Trappc1	Rat	paracetamol	increases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of TRAPPC1 mRNA	CTD	PMID:22230336
Trappc1	Rat	poly(vinylpyrrolidone)	multiple interactions	EXP		6480464	[Silver analog co-treated with Povidone] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:25194297
Trappc1	Rat	resveratrol	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:23557933
Trappc1	Rat	silver atom	multiple interactions	EXP		6480464	[Silver analog co-treated with Povidone] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:25194297
Trappc1	Rat	silver(0)	multiple interactions	EXP		6480464	[Silver analog co-treated with Povidone] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:25194297
Trappc1	Rat	sodium arsenite	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of TRAPPC1 mRNA	CTD	PMID:38568856
Trappc1	Rat	sodium arsenite	multiple interactions	ISO	TRAPPC1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TRAPPC1 mRNA	CTD	PMID:39836092
Trappc1	Rat	sodium arsenite	increases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of TRAPPC1 mRNA	CTD	PMID:34032870
Trappc1	Rat	tert-butyl hydroperoxide	increases expression	ISO	Trappc1 (Mus musculus)	6480464	tert-Butylhydroperoxide results in increased expression of TRAPPC1 mRNA	CTD	PMID:15003993
Trappc1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of TRAPPC1 mRNA	CTD	PMID:31150632 and PMID:33387578
Trappc1	Rat	tetrachloromethane	decreases expression	ISO	Trappc1 (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of TRAPPC1 mRNA	CTD	PMID:31919559
Trappc1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TRAPPC1 mRNA]	CTD	PMID:31150632
Trappc1	Rat	thiram	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Thiram results in decreased expression of TRAPPC1 mRNA	CTD	PMID:38568856
Trappc1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of TRAPPC1 mRNA	CTD	PMID:25729387
Trappc1	Rat	triphenyl phosphate	affects expression	ISO	TRAPPC1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of TRAPPC1 mRNA	CTD	PMID:37042841
Trappc1	Rat	triptonide	increases expression	ISO	Trappc1 (Mus musculus)	6480464	triptonide results in increased expression of TRAPPC1 mRNA	CTD	PMID:33045310
Trappc1	Rat	tunicamycin	decreases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Tunicamycin results in decreased expression of TRAPPC1 mRNA	CTD	PMID:22378314
Trappc1	Rat	valproic acid	increases expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of TRAPPC1 mRNA	CTD	PMID:23179753 and PMID:28001369
Trappc1	Rat	valproic acid	affects expression	ISO	TRAPPC1 (Homo sapiens)	6480464	Valproic Acid affects the expression of TRAPPC1 mRNA	CTD	PMID:25979313
Trappc1	Rat	valproic acid	increases methylation	ISO	TRAPPC1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of TRAPPC1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trappc1	Rat	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	IBA	PANTHER:PTN000583159 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Trappc1	Rat	vesicle-mediated transport	involved_in	IEA	InterPro:IPR007233	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trappc1	Rat	vesicle-mediated transport	involved_in	IEA	UniProtKB-KW:KW-0931	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trappc1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Trappc1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Trappc1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Trappc1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Trappc1	Rat	TRAPP complex	part_of	IEA	InterPro:IPR007233	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trappc1	Rat	TRAPP complex	part_of	IEA	UniProtKB:Q5NCF2 and ensembl:ENSMUSP00000099662	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Trappc1	Rat	TRAPP complex	part_of	ISO	Trappc1 (Mus musculus)	1624291	PMID:17027922	RGD	PMID:17027922
Trappc1	Rat	TRAPP complex	part_of	IBA	FB:FBgn0260860 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trappc1	Rat	protein binding	enables	ISO	TRAPPC1 (Homo sapiens)	1624291	UniProtKB:O43617 more ...	RGD	PMID:28514442 more ...
Trappc1	Rat	protein binding	enables	ISO	Trappc1 (Mus musculus)	1624291	PR:O55013 more ...	RGD	PMID:17027922

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:17027922	PMID:19710508

Trappc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,544,406 - 54,545,992 (+)	NCBI		GRCr8
mRatBN7.2	10	54,045,598 - 54,047,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,045,537 - 54,047,331 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,707,276 - 58,708,862 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,195,890 - 58,197,476 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,704,035 - 53,705,621 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	55,924,996 - 55,926,582 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	55,924,938 - 55,926,783 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,667,071 - 55,668,657 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,117,229 - 56,118,815 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,130,805 - 56,132,585 (+)	NCBI
Celera	10	53,202,167 - 53,203,753 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

TRAPPC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,930,345 - 7,931,999 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,930,345 - 7,932,123 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,833,663 - 7,835,317 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,774,392 - 7,775,988 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	7,774,391 - 7,775,983	NCBI
Celera	17	7,861,377 - 7,863,031 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,728,261 - 7,729,915 (-)	NCBI		HuRef
CHM1_1	17	7,842,450 - 7,844,104 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,835,773 - 7,837,427 (-)	NCBI		T2T-CHM13v2.0

Trappc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,214,812 - 69,216,619 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,214,806 - 69,216,619 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,323,986 - 69,325,793 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,323,980 - 69,325,793 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,137,488 - 69,139,295 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,140,175 - 69,141,988 (+)	NCBI		MGSCv36	mm8
Celera	11	76,277,969 - 76,279,776 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.51	NCBI

Trappc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	9,011,138 - 9,012,796 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	9,010,936 - 9,012,796 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRAPPC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	15,528,523 - 15,530,355 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	17,494,530 - 17,496,243 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,965,454 - 7,967,172 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,951,885 - 7,953,654 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,951,885 - 7,953,365 (-)	Ensembl	panpan1.1		panPan2

TRAPPC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,784,577 - 32,786,060 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,784,846 - 32,786,163 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,921,414 - 32,923,121 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,887,252 - 32,888,959 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,887,521 - 32,888,838 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,854,947 - 32,856,654 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,810,979 - 32,812,686 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,990,117 - 32,991,824 (-)	NCBI		UU_Cfam_GSD_1.0

Trappc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,698,737 - 47,700,317 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	1,172,943 - 1,174,510 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	1,172,957 - 1,174,517 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRAPPC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	53,179,257 - 53,180,981 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	55,545,614 - 55,547,313 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRAPPC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	7,318,771 - 7,320,461 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	7,318,911 - 7,320,343 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	14,087,647 - 14,089,372 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trappc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	10,512,587 - 10,514,213 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	10,512,569 - 10,514,504 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Trappc1
1 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	69
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000057079
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001039378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY903234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY903235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY903236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY903237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY903238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057079 ⟹ ENSRNOP00000053911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,045,537 - 54,047,331 (+)	Ensembl
Rnor_6.0 Ensembl	10	55,924,996 - 55,926,582 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087003 ⟹ ENSRNOP00000075251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	55,924,938 - 55,926,783 (+)	Ensembl

RefSeq Acc Id:

NM_001039378 ⟹ NP_001034467

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,544,406 - 54,545,992 (+)	NCBI
mRatBN7.2	10	54,045,598 - 54,047,184 (+)	NCBI
Rnor_6.0	10	55,924,996 - 55,926,582 (+)	NCBI
Rnor_5.0	10	55,667,071 - 55,668,657 (+)	NCBI
RGSC_v3.4	10	56,117,229 - 56,118,815 (+)	RGD
Celera	10	53,202,167 - 53,203,753 (+)	RGD

Sequence:

show sequence

ACCGGAAGTAGCTTGTCACCCTCATTTAGGGCAATTCCGATGACTGTCCACAATCTGTATCTTTTTGACCGGAATGGAGTGTGTCTACACTACAGCGAATGGCACCGCAAGAAGCAAGCAGGGATCCC
TAAGGAAGAGGAGTACAAGCTGATGTATGGGATGCTCTTCTCCATTCGTTCGTTTGTCAGCAAGATGTCCCCGCTAGACATGAAGGATGGCTTTCTATCTTTCCAAACTAGCCGTTACAAACTCCATT
ACTACGAGACTCCCACTGGAATCAAGGTTGTCATGAATACTGACTTGGGCGTGGGCCCTATCCGAGATGTTCTACACCATATCTACAGTGCGCTGTATGTGGAGTTTGTTGTGAAGAATCCTCTGTGC
CCGCTGGGACAAACTGTGCAAAGTGAACTCTTCCGATCCCGGCTAGACTCCTATGTCCGATCTTTGCCCTTCTTCTCTGCTCGAGCTGGCTGACACATCTACCTCACCCCTCAGAAGAACCCGTGACT
GCCTGGGCCCATCTCACTTGTTGCAATTTGAGCCCTTC

hide sequence


Protein RefSeqs	NP_001034467	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX85364	(Get FASTA)	NCBI Sequence Viewer
	AAX85365	(Get FASTA)	NCBI Sequence Viewer
	AAX85366	(Get FASTA)	NCBI Sequence Viewer
	AAX85367	(Get FASTA)	NCBI Sequence Viewer
	AAX85368	(Get FASTA)	NCBI Sequence Viewer
	EDM04853	(Get FASTA)	NCBI Sequence Viewer
	EDM04855	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053911
	ENSRNOP00000053911.2
GenBank Protein	Q2KMM2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001034467 ⟸ NM_001039378
- UniProtKB:	Q2KMM2 (UniProtKB/Swiss-Prot), A6HFP7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLSFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVEFVVKNPLCPLGQTVQSELFRS RLDSYVRSLPFFSARAG hide sequence

Ensembl Acc Id:

ENSRNOP00000053911 ⟸ ENSRNOT00000057079

Ensembl Acc Id:

ENSRNOP00000075251 ⟸ ENSRNOT00000087003

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q2KMM2-F1-model_v2	AlphaFold	Q2KMM2	1-145	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697330

Promoter ID:

EPDNEW_R7834

Type:

initiation region

Name:

Trappc1_1

Description:

trafficking protein particle complex 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	55,924,992 - 55,925,052	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24563	BioCyc
Ensembl Genes	ENSRNOG00000037627	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000057079	ENTREZGENE
	ENSRNOT00000057079.3	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.450.70	UniProtKB/Swiss-Prot
InterPro	Longin-like_dom_sf	UniProtKB/Swiss-Prot
	TRAPPC	UniProtKB/Swiss-Prot
KEGG Report	rno:287427	UniProtKB/Swiss-Prot
NCBI Gene	287427	ENTREZGENE
PANTHER	PTHR23249	UniProtKB/Swiss-Prot
	TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 1	UniProtKB/Swiss-Prot
Pfam	Sybindin	UniProtKB/Swiss-Prot
PhenoGen	Trappc1	PhenoGen
RatGTEx	ENSRNOG00000037627	RatGTEx
SMART	Sybindin	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF64356	UniProtKB/Swiss-Prot
UniProt	A6HFP7	ENTREZGENE, UniProtKB/TrEMBL
	A6HFQ0_RAT	UniProtKB/TrEMBL
	Q2KMM2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-02-18	Trappc1	trafficking protein particle complex subunit 1	Trappc1	trafficking protein particle complex 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Trappc1	trafficking protein particle complex 1			Symbol and Name updated	1299863	APPROVED
2006-03-07	Trappc1	trafficking protein particle complex 1	Trappc1_predicted	trafficking protein particle complex 1 (predicted)	Symbol and Name status set to approved	1299863	APPROVED
2005-01-12	Trappc1_predicted	trafficking protein particle complex 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar