Advanced Search (OLGA)

Gene: Dmap1 (DNA methyltransferase 1-associated protein 1) Rattus norvegicus

Analyze

Symbol:

Dmap1

Name:

DNA methyltransferase 1-associated protein 1

RGD ID:

1311295

Description:

Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity and transcription corepressor activity. Involved in response to ethanol. Predicted to be located in cytoplasm; nucleus; and replication fork. Predicted to be part of NuA4 histone acetyltransferase complex; Swr1 complex; and nucleosome. Orthologous to human DMAP1 (DNA methyltransferase 1 associated protein 1); PARTICIPATES IN INO80 family mediated chromatin remodeling pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC298447; MGC109435

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DMAP1 (DNA methyltransferase 1 associated protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dmap1 (DNA methyltransferase 1-associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dmap1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DMAP1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DMAP1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dmap1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DMAP1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DMAP1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dmap1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dmap1 (DNA methyltransferase 1 associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DMAP1 (DNA methyltransferase 1 associated protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dmap1 (DNA methyltransferase 1-associated protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dmap1 (DNA methyltransferase 1 associated protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	DMAP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SWC4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SWC4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ekl-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dmap1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	dmap1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	136,380,211 - 136,388,229 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	136,380,216 - 136,388,219 (-)	Ensembl				GRCr8
mRatBN7.2	5	131,143,726 - 131,151,760 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	131,143,729 - 131,151,742 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	133,766,584 - 133,774,602 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	135,521,181 - 135,529,199 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	135,543,616 - 135,551,634 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	136,533,791 - 136,541,795 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	136,533,792 - 136,541,795 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	140,323,214 - 140,331,218 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	137,997,648 - 138,005,652 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	129,662,107 - 129,670,111 (-)	NCBI		Celera
RGSC_v3.1	5	138,002,874 - 138,010,878 (-)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

epilepsy (ISO)

Muscle Hypotonia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aristolochic acid A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

corosolic acid (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dimethyl sulfoxide (ISO)

doxorubicin (ISO)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

furan (EXP)

indometacin (ISO)

methylmercury chloride (ISO)

paracetamol (EXP)

potassium chromate (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tributylstannane (EXP)

troglitazone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin organization (IEA)

chromatin remodeling (IEA)

DNA repair (IEA)

DNA-templated transcription (IEA)

negative regulation of DNA-templated transcription (IEA)

negative regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

positive regulation of double-strand break repair via homologous recombination (IEA,ISO)

positive regulation of protein import into nucleus (IEA,ISO)

regulation of cell cycle (IEA,ISO)

response to ethanol (IEP)

Cellular Component

chromosome (IEA)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

NuA4 histone acetyltransferase complex (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

replication fork (IEA,ISO)

Swr1 complex (IBA)

Molecular Function

protein binding (ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

transcription corepressor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

INO80 family mediated chromatin remodeling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Effects of topiramate on ethanol-cocaine interactions and DNA methyltransferase gene expression in the rat prefrontal cortex.	Echeverry-Alzate V, etal., Br J Pharmacol. 2014 Jun;171(12):3023-36. doi: 10.1111/bph.12636.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	The INO80 family of chromatin-remodeling enzymes: regulators of histone variant dynamics.	Watanabe S and Peterson CL, Cold Spring Harb Symp Quant Biol. 2010;75:35-42. doi: 10.1101/sqb.2010.75.063. Epub 2011 Apr 18.

Additional References at PubMed

PMID:10888872	PMID:14966270	PMID:15367675

Genomics

Comparative Map Data

Dmap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	136,380,211 - 136,388,229 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	136,380,216 - 136,388,219 (-)	Ensembl				GRCr8
mRatBN7.2	5	131,143,726 - 131,151,760 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	131,143,729 - 131,151,742 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	133,766,584 - 133,774,602 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	135,521,181 - 135,529,199 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	135,543,616 - 135,551,634 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	136,533,791 - 136,541,795 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	136,533,792 - 136,541,795 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	140,323,214 - 140,331,218 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	137,997,648 - 138,005,652 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	129,662,107 - 129,670,111 (-)	NCBI		Celera
RGSC_v3.1	5	138,002,874 - 138,010,878 (-)	NCBI
Cytogenetic Map	5	q36	NCBI

DMAP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	44,213,471 - 44,220,673 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	44,213,427 - 44,220,681 (+)	Ensembl			hg38	GRCh38
GRCh37	1	44,679,143 - 44,686,345 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	44,451,712 - 44,458,938 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	44,348,255 - 44,355,437	NCBI
Celera	1	42,962,448 - 42,969,674 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	42,792,967 - 42,800,193 (+)	NCBI		HuRef
CHM1_1	1	44,794,645 - 44,801,871 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	44,084,361 - 44,091,563 (+)	NCBI		T2T-CHM13v2.0

Dmap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	117,531,878 - 117,539,450 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	117,531,878 - 117,539,470 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	117,674,681 - 117,682,321 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	117,674,681 - 117,682,273 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	117,347,291 - 117,354,830 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	117,172,618 - 117,180,157 (-)	NCBI		MGSCv36	mm8
Celera	4	116,406,206 - 116,413,745 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.46	NCBI

Dmap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	13,982,713 - 13,993,410 (-)	Ensembl
ChiLan1.0	NW_004955464	13,984,748 - 13,993,411 (-)	NCBI	ChiLan1.0	ChiLan1.0

DMAP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	182,587,282 - 182,594,645 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	181,728,642 - 181,736,005 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	43,516,839 - 43,524,206 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	44,886,268 - 44,893,598 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	44,886,307 - 44,893,598 (+)	Ensembl			panPan2	panpan1.1

DMAP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	16,077,164 - 16,085,666 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	16,077,206 - 16,085,687 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	16,198,911 - 16,207,486 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	16,230,386 - 16,238,965 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	16,230,389 - 16,238,927 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	16,030,276 - 16,038,851 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	16,098,334 - 16,106,907 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	16,171,441 - 16,180,027 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dmap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	59,661,676 - 59,671,125 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	25,486,462 - 25,495,992 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	25,486,447 - 25,495,909 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DMAP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	167,082,849 - 167,091,630 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	167,083,053 - 167,091,654 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

DMAP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	88,570,281 - 88,577,747 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	88,570,341 - 88,577,306 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	28,344,984 - 28,352,253 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dmap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624906	109,065 - 117,571 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624906	109,233 - 117,571 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dmap1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	41,283,468 - 41,291,463 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dmap1
78 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	23
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000026336
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133308734	140009902	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001015006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC092651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026336 ⟹ ENSRNOP00000026336

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	136,380,216 - 136,388,219 (-)	Ensembl
mRatBN7.2 Ensembl	5	131,143,731 - 131,151,742 (-)	Ensembl
Rnor_6.0 Ensembl	5	136,533,792 - 136,541,795 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103581 ⟹ ENSRNOP00000085987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	136,380,216 - 136,387,912 (-)	Ensembl
mRatBN7.2 Ensembl	5	131,143,729 - 131,151,435 (-)	Ensembl

RefSeq Acc Id:

NM_001015006 ⟹ NP_001015006

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	136,380,215 - 136,388,219 (-)	NCBI
mRatBN7.2	5	131,143,730 - 131,151,742 (-)	NCBI
Rnor_6.0	5	136,533,791 - 136,541,795 (-)	NCBI
Rnor_5.0	5	140,323,214 - 140,331,218 (-)	NCBI
RGSC_v3.4	5	137,997,648 - 138,005,652 (-)	RGD
Celera	5	129,662,107 - 129,670,111 (-)	RGD

Sequence:

show sequence

GTTTCTATCCGTGGGTCTTCAGAAAGAGATAACCTGAGGAGTGGGCTACAGCTGGAGTACTCAG
GTACTGACCCTTGACCTCGGGGTGCTACCTCATCCCTCAGGCGTGATGGCTACGGGCGCAGATG
TACGAGACATTCTAGAACTCGGGGGTCCAGAGGGAGATGCCGCTTCTGGGACCATCAGCAAAAA
GGATATTATCAACCCGGACAAGAAAAAGTCCAAGAAGTCCTCAGAGACACTGACCTTCAAGAGG
CCGGAGGGCATGCATCGGGAGGTCTATGCTTTGCTTTACTCTGACAAAAAGGACGCACCCCCAC
TGCTTCCCAGTGACACCGGTCAGGGGTACCGGACAGTGAAGGCTAAGTTGGGGTCCAAGAAGGT
CCGACCTTGGAAGTGGATGCCATTTACCAACCCAGCTCGAAAGGATGGTGCTATGTTTTTCCAC
TGGCGCCGAGCAGCGGAGGAGGGCAAGGACTACCCTTTCGCCAGGTTCAATAAGACAGTACAGG
TGCCGGTGTACTCAGAGCAGGAGTACCAGCTCTACCTTCACGATGATGCATGGACTAAGGCAGA
GACTGACCATCTCTTTGACCTCAGCCGCCGATTTGATTTGCGCTTCGTAGTTATTCACGATCGG
TATGACCACCAGCAGTACAAGAAGCGTTCTGTGGAGGACCTGAAAGAGAGGTACTACCACATTT
GTGCTAAGCTTGCCAACGTGAGGGCTGTGCCAGGTACAGATCTCAAAATACCAGTATTTGATGC
TGGACATGAGAGACGGCGGAAGGAACAGCTGGAGAGACTTTACAACCGAACCCCAGAGCAGGTG
GCAGAGGAGGAGTACCTGCTCCAGGAGCTTCGTAAGATTGAGGCCCGGAAAAAAGAGCGGGAGA
AGCGCAGCCAAGACCTGCAGAAGCTGATTACCGCAGCAGACACCACCGCAGAGCAGCGGCGCAC
AGAACGCAAGGCTCCCAAGAAGAAGCTACCCCAGAAGAAGGAGGCCGAGAAGCCGGCTGTTCCT
GAGACTGCGGGCATCAAGTTCCCAGACTTTAAGTCAGCGGGTGTGACATTACGGAGCCAGCGGA
TGAAGCTGCCCAGCTCTGTGGGTCAGAAGAAGATCAAGGCGCTGGAACAGATGCTGCTGGAACT
TGGTGTGGAGCTGAGCCCTACGCCCACAGAGGAGCTGGTGCATATGTTCAATGAGTTGCGGAGT
GACCTGGTGTTACTCTACGAGCTCAAGCAGGCCTGTGCCAACTGTGAATATGAGCTGCAGATGC
TACGGCACCGGCATGAGGCTCTGGCTCGGGCAGGAGTGCTGGGGGGCCCTGCCACACCAGCAGT
GGGACCAACCCCAGCGTCTGCTGAGCCAACAGTGTCTGAATCTGGACTTGGTCTTGACCCTAGC
AAGGACACCATCATTGATGTCGTGGGTGCACCGCTCACACCCAATTCGCGGAAACGACGGGAAT
CAGCCTCCAGCTCATCTTCTGTGAAGAAAGCCAAGAAACCATAAGGGGCCATCAGAGTTGGTGG
TATGGTGTAAATAGAGCTGTTAAGTTGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039109606 ⟹ XP_038965534

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	136,380,211 - 136,388,229 (-)	NCBI
mRatBN7.2	5	131,143,726 - 131,151,760 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001015006	(Get FASTA)	NCBI Sequence Viewer
	XP_038965534	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92651	(Get FASTA)	NCBI Sequence Viewer
	EDL90211	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026336
	ENSRNOP00000026336.4
	ENSRNOP00000085987.1

RefSeq Acc Id:

NP_001015006 ⟸ NM_001015006

- UniProtKB:

Q568Y6 (UniProtKB/TrEMBL), F7FQE3 (UniProtKB/TrEMBL), A0A8I6A1B5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSD
KKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFAR
FNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQYKKRSVEDLK
ERYYHICAKLANVRAVPGTDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEA
RKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGV
TLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEELVHMFNELRSDLVLLYELKQACANC
EYELQMLRHRHEALARAGVLGGPATPAVGPTPASAEPTVSESGLGLDPSKDTIIDVVGAPLTPN
SRKRRESASSSSSVKKAKKP

hide sequence

Ensembl Acc Id:

ENSRNOP00000026336 ⟸ ENSRNOT00000026336

RefSeq Acc Id:	XP_038965534 ⟸ XM_039109606
- Peptide Label:	isoform X1
- UniProtKB:	Q568Y6 (UniProtKB/TrEMBL), F7FQE3 (UniProtKB/TrEMBL), A0A8I6A1B5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085987 ⟸ ENSRNOT00000103581

Protein Domains

DAMP1 SANT/Myb-like DNA methyltransferase 1-associated

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q568Y6-F1-model_v2	AlphaFold	Q568Y6	1-468	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693954

Promoter ID:

EPDNEW_R4479

Type:

multiple initiation site

Name:

Dmap1_1

Description:

DNA methyltransferase 1-associated protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	136,541,807 - 136,541,867	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311295	AgrOrtholog
BioCyc Gene	G2FUF-40193	BioCyc
Ensembl Genes	ENSRNOG00000019407	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026336	ENTREZGENE
	ENSRNOT00000026336.7	UniProtKB/TrEMBL
	ENSRNOT00000103581.2	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7319534	IMAGE-MGC_LOAD
InterPro	DAMP1_SANT_like	UniProtKB/TrEMBL
	DMAP1	UniProtKB/TrEMBL
	Swc4/Dmap1	UniProtKB/TrEMBL
KEGG Report	rno:298447	UniProtKB/TrEMBL
MGC_CLONE	MGC:109435	IMAGE-MGC_LOAD
NCBI Gene	298447	ENTREZGENE
PANTHER	DNA METHYLTRANSFERASE 1-ASSOCIATED PROTEIN 1	UniProtKB/TrEMBL
	PTHR12855	UniProtKB/TrEMBL
Pfam	DMAP1	UniProtKB/TrEMBL
	SANT_DAMP1_like	UniProtKB/TrEMBL
PhenoGen	Dmap1	PhenoGen
RatGTEx	ENSRNOG00000019407	RatGTEx
UniProt	A0A8I6A1B5	ENTREZGENE, UniProtKB/TrEMBL
	F7FQE3	ENTREZGENE, UniProtKB/TrEMBL
	Q568Y6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Dmap1	DNA methyltransferase 1-associated protein 1	Dmap1_predicted	DNA methyltransferase 1-associated protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Dmap1_predicted	DNA methyltransferase 1-associated protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations