Advanced Search (OLGA)

Gene: Twsg1 (twisted gastrulation BMP signaling modulator 1) Rattus norvegicus

Analyze

Symbol:

Twsg1

Name:

twisted gastrulation BMP signaling modulator 1

RGD ID:

1311215

Description:

Predicted to enable heparin binding activity and transforming growth factor beta binding activity. Predicted to be involved in negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of cytokine production; and regulation of transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including BMP signaling pathway; negative regulation of osteoblast differentiation; and regulation of BMP signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human TWSG1 (twisted gastrulation BMP signaling modulator 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; dibutyl phthalate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC363294; twisted gastrulation homolog 1; twisted gastrulation homolog 1 (Drosophila); twisted gastrulation protein homolog 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	RGD	RGD
Mus musculus (house mouse):	Twsg1 (twisted gastrulation BMP signaling modulator 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Twsg1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Twsg1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Twsg1 (twisted gastrulation BMP signaling modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR52N4 (olfactory receptor family 52 subfamily N member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TWSG1 (twisted gastrulation BMP signaling modulator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Twsg1 (twisted gastrulation BMP signaling modulator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	twsg1b (twisted gastrulation BMP signaling modulator 1b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	twsg1b (twisted gastrulation BMP signaling modulator 1b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	twsg1a (twisted gastrulation BMP signaling modulator 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	cv	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	cv	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	srw	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	tsg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	twsg1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	twsg1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	twsg2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	twsg2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	112,979,972 - 113,014,315 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	112,979,972 - 113,014,315 (-)	Ensembl				GRCr8
mRatBN7.2	9	105,533,116 - 105,567,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	105,533,136 - 105,567,479 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	113,944,806 - 113,973,639 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	119,054,620 - 119,083,679 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	117,410,654 - 117,439,487 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	113,699,151 - 113,732,601 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	113,699,170 - 113,732,622 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	113,230,657 - 113,264,099 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	104,694,731 - 104,729,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	102,911,360 - 102,940,263 (-)	NCBI		Celera
RGSC_v3.1	9	104,907,180 - 104,938,570 (-)	NCBI
Cytogenetic Map	9	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

holoprosencephaly (ISO)

Jaw Abnormalities (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dioxygen (ISO)

ethanol (ISO)

fluoranthene (ISO)

folic acid (ISO)

glafenine (EXP)

ivermectin (ISO)

methapyrilene (EXP)

methoxychlor (EXP)

methylphenidate (ISO)

nitrates (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phosphane (EXP)

poly(I:C) (EXP)

testosterone (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

BMP signaling pathway (ISO)

camera-type eye development (ISO)

cell differentiation (ISO)

forebrain development (ISO)

hemopoiesis (ISO)

mesoderm formation (ISO)

negative regulation of BMP signaling pathway (ISO)

negative regulation of CD4-positive, alpha-beta T cell activation (IEA,ISO)

negative regulation of CD4-positive, alpha-beta T cell proliferation (IEA,ISO)

negative regulation of cytokine production (IEA,ISO)

negative regulation of osteoblast differentiation (ISO)

ossification (ISO)

positive regulation of BMP signaling pathway (ISO)

positive regulation of SMAD protein signal transduction (IEA,ISO)

positive regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

regulation of BMP signaling pathway (IBA)

salivary gland morphogenesis (ISO)

tissue development (ISO)

Cellular Component

centrosome (IEA,ISO)

cytosol (IEA,ISO)

extracellular region (IEA)

extracellular space (IBA,IEA,ISO)

Molecular Function

heparin binding (IEA,ISO)

protein binding (ISO)

transforming growth factor beta binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12665593	PMID:14681194	PMID:15013800	PMID:15780974	PMID:15843411	PMID:16289463	PMID:17164348	PMID:23376485

Genomics

Comparative Map Data

Twsg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	112,979,972 - 113,014,315 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	112,979,972 - 113,014,315 (-)	Ensembl				GRCr8
mRatBN7.2	9	105,533,116 - 105,567,460 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	105,533,136 - 105,567,479 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	113,944,806 - 113,973,639 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	119,054,620 - 119,083,679 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	117,410,654 - 117,439,487 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	113,699,151 - 113,732,601 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	113,699,170 - 113,732,622 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	113,230,657 - 113,264,099 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	104,694,731 - 104,729,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	102,911,360 - 102,940,263 (-)	NCBI		Celera
RGSC_v3.1	9	104,907,180 - 104,938,570 (-)	NCBI
Cytogenetic Map	9	q37	NCBI

TWSG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	9,334,773 - 9,402,420 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	9,334,694 - 9,402,420 (+)	Ensembl			hg38	GRCh38
GRCh37	18	9,334,771 - 9,402,418 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	9,324,851 - 9,392,418 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	9,324,850 - 9,392,417	NCBI
Celera	18	9,219,304 - 9,286,615 (+)	NCBI		Celera
Cytogenetic Map	18	p11.22	NCBI
HuRef	18	9,298,467 - 9,364,729 (+)	NCBI		HuRef
CHM1_1	18	9,334,596 - 9,402,161 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	9,497,987 - 9,565,608 (+)	NCBI		T2T-CHM13v2.0

Twsg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	66,230,060 - 66,258,198 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	66,228,967 - 66,258,221 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	65,923,065 - 65,951,187 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	65,921,972 - 65,951,226 (-)	Ensembl			mm10	GRCm38
MGSCv37	17	66,272,405 - 66,300,527 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	65,822,609 - 65,850,673 (-)	NCBI		MGSCv36	mm8
Celera	17	70,231,747 - 70,259,874 (-)	NCBI		Celera
Cytogenetic Map	17	E1.1	NCBI
cM Map	17	35.26	NCBI

Twsg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	2,652,020 - 2,686,117 (-)	Ensembl
ChiLan1.0	NW_004955402	2,652,020 - 2,685,350 (-)	NCBI	ChiLan1.0	ChiLan1.0

TWSG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	29,048,226 - 29,115,502 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	14,740,820 - 14,808,080 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	4,883,688 - 4,950,963 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	7,164,091 - 7,229,271 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	7,164,091 - 7,229,271 (-)	Ensembl			panPan2	panpan1.1

TWSG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	75,337,347 - 75,397,485 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	75,335,235 - 75,398,325 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	74,725,544 - 74,790,454 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	75,385,087 - 75,451,743 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	75,385,019 - 75,452,636 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	7	75,106,123 - 75,167,742 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	75,411,428 - 75,477,211 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Twsg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	2,673,370 - 2,720,055 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	1,901,680 - 1,946,460 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936626	1,901,686 - 1,946,554 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TWSG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	98,625,505 - 98,678,258 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	98,629,116 - 98,678,322 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	91,965,863 - 92,015,046 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TWSG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	68,225,350 - 68,289,458 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	68,225,343 - 68,290,969 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	43,175,298 - 43,240,621 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Twsg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624770	18,047,810 - 18,081,761 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624770	18,047,790 - 18,081,559 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Twsg1
312 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	594
Count of miRNA genes:	294
Interacting mature miRNAs:	360
Transcripts:	ENSRNOT00000017915
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	85262459	118999486	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	86720043	121768150	Rat

Markers in Region

RH133016

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	105,560,202 - 105,560,402 (-)	MAPPER	mRatBN7.2
mRatBN7.2	9	105,560,202 - 105,560,402 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	113,706,234 - 113,706,433	NCBI	Rnor6.0
Rnor_6.0	9	113,796,009 - 113,796,208	NCBI	Rnor6.0
Rnor_5.0	9	113,325,201 - 113,325,400	UniSTS	Rnor5.0
Rnor_5.0	9	113,237,728 - 113,237,927	UniSTS	Rnor5.0
RGSC_v3.4	9	104,721,822 - 104,722,021	UniSTS	RGSC3.4
Celera	9	102,935,242 - 102,935,441	UniSTS
Cytogenetic Map	9	q37	UniSTS

RH133800

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	105,534,350 - 105,534,535 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	113,731,182 - 113,731,366	NCBI	Rnor6.0
Rnor_5.0	9	113,262,676 - 113,262,860	UniSTS	Rnor5.0
RGSC_v3.4	9	104,695,970 - 104,696,154	UniSTS	RGSC3.4
Celera	9	102,909,398 - 102,909,582	UniSTS
Cytogenetic Map	9	q37	UniSTS

RH141244

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	105,533,226 - 105,533,444 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	113,732,273 - 113,732,490	NCBI	Rnor6.0
Rnor_5.0	9	113,263,767 - 113,263,984	UniSTS	Rnor5.0
RGSC_v3.4	9	104,694,846 - 104,695,063	UniSTS	RGSC3.4
Celera	9	102,908,083 - 102,908,491	UniSTS
RH 3.4 Map	8	1156.49	UniSTS
Cytogenetic Map	9	q37	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001412824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017915 ⟹ ENSRNOP00000017915

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	112,979,972 - 113,014,315 (-)	Ensembl
mRatBN7.2 Ensembl	9	105,533,136 - 105,567,479 (-)	Ensembl
Rnor_6.0 Ensembl	9	113,699,170 - 113,732,622 (+)	Ensembl

RefSeq Acc Id:

NM_001108811 ⟹ NP_001102281

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,979,972 - 113,014,315 (-)	NCBI
mRatBN7.2	9	105,533,116 - 105,567,460 (-)	NCBI
Rnor_6.0	9	113,701,476 - 113,729,404 (+)	NCBI
Rnor_5.0	9	113,230,657 - 113,264,099 (+)	NCBI
RGSC_v3.4	9	104,694,731 - 104,729,090 (-)	RGD
Celera	9	102,911,360 - 102,940,263 (-)	NCBI

Sequence:

show sequence

ATGAATTCACACCATGTTGTGCTAACTCTAGCCTCCCTGATGTTCCTGATGTGCCTCCCTGTGT
CACAGAGCTGTAACAAAGCACTCTGTGCCAGCGATGTGAGCAAGTGCCTCATTCAGGAGCTGTG
CCAGTGCCGGCCTGGGGAAGGAAACTGCCCCTGCTGTAAGGAGTGCATGCTGTGCCTCGGGGCC
CTGTGGGATGAGTGTTGCGATTGTGTCGGTATGTGCAACCCTCGGAATTACAGCGACACACCTC
CCACTTCAAAGAGCACAGTGGAGGAGCTGCATGAGCCCATCCCCTCCCTGTTCAGGGCCCTGAC
AGAGGGCGACACCCAGCTGAACTGGAACATCGTGTCCTTTCCGGTGGCAGAGGAGCTGACACAC
CACGAAAATCTCGTCTCCTTTCTAGAAACCGTGAACCAGCCACATCACCAAAATGTGTCTGTTC
CCAGCAACAATGTTCACGCCCCTTTTCCCAGCGACAAAGAGCACATGTGCACTGTGGTGTACTT
TGATGACTGCATGTCCATACACCAGTGTAAGATCTCCTGTGAGTCCATGGGAGCGTCCAAATAC
CGCTGGTTTCACAACGCCTGCTGCGAGTGCGTCGGCCCGGAGTGCATCGACTATGGCAGCAAGA
CTGTCAAGTGCATGAACTGCATGTTTTAA

hide sequence

RefSeq Acc Id:

NM_001412824 ⟹ NP_001399753

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	112,979,972 - 113,014,315 (-)	NCBI
mRatBN7.2	9	105,533,116 - 105,567,460 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102281	(Get FASTA)	NCBI Sequence Viewer
	NP_001399753	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91800	(Get FASTA)	NCBI Sequence Viewer
	EDL91801	(Get FASTA)	NCBI Sequence Viewer
	EDL91802	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017915
	ENSRNOP00000017915.3

RefSeq Acc Id:	NP_001102281 ⟸ NM_001108811
- Peptide Label:	precursor
- UniProtKB:	D4A9T2 (UniProtKB/TrEMBL), A6JRD5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNSHHVVLTLASLMFLMCLPVSQSCNKALCASDVSKCLIQELCQCRPGEGNCPCCKECMLCLGA LWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELTH HENLVSFLETVNQPHHQNVSVPSNNVHAPFPSDKEHMCTVVYFDDCMSIHQCKISCESMGASKY RWFHNACCECVGPECIDYGSKTVKCMNCMF hide sequence

Ensembl Acc Id:

ENSRNOP00000017915 ⟸ ENSRNOT00000017915

RefSeq Acc Id:	NP_001399753 ⟸ NM_001412824
- Peptide Label:	precursor
- UniProtKB:	D4A9T2 (UniProtKB/TrEMBL), A6JRD5 (UniProtKB/TrEMBL)

Protein Domains

Tsg C-terminal Tsg N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A9T2-F1-model_v2	AlphaFold	D4A9T2	1-222	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696905

Promoter ID:

EPDNEW_R7429

Type:

multiple initiation site

Name:

Twsg1_1

Description:

twisted gastrulation BMP signaling modulator 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	113,699,173 - 113,699,233	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311215	AgrOrtholog
BioCyc Gene	G2FUF-26476	BioCyc
Ensembl Genes	ENSRNOG00000013340	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017915	ENTREZGENE
	ENSRNOT00000017915.7	UniProtKB/TrEMBL
InterPro	Tsg	UniProtKB/TrEMBL
	Tsg_C	UniProtKB/TrEMBL
	Tsg_N	UniProtKB/TrEMBL
KEGG Report	rno:363294	UniProtKB/TrEMBL
NCBI Gene	363294	ENTREZGENE
PANTHER	Tsg	UniProtKB/TrEMBL
	TWISTED GASTRULATION PROTEIN HOMOLOG 1	UniProtKB/TrEMBL
Pfam	Tsg	UniProtKB/TrEMBL
	Tsg_N	UniProtKB/TrEMBL
PhenoGen	Twsg1	PhenoGen
RatGTEx	ENSRNOG00000013340	RatGTEx
UniProt	A6JRD5	ENTREZGENE, UniProtKB/TrEMBL
	D4A9T2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-11	Twsg1	twisted gastrulation BMP signaling modulator 1	Twsg1	twisted gastrulation homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Twsg1	twisted gastrulation homolog 1 (Drosophila)	Twsg1_predicted	twisted gastrulation homolog 1 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Twsg1_predicted	twisted gastrulation homolog 1 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD