Symbol:
Ptgir
Name:
prostaglandin I2 receptor
RGD ID:
1310890
Description:
Predicted to enable prostacyclin receptor activity. Predicted to be involved in several processes, including adenylate cyclase-activating G protein-coupled receptor signaling pathway; negative regulation of platelet-derived growth factor receptor signaling pathway; and negative regulation of smooth muscle cell proliferation. Predicted to act upstream of or within response to lipopolysaccharide. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Orthologous to human PTGIR (prostaglandin I2 receptor); PARTICIPATES IN eicosanoid signaling pathway; prostaglandin I2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC292661; PGI receptor; PGI2 receptor; prostacyclin receptor; prostaglandin I receptor (IP); prostaglandin I2 (prostacyclin) receptor; prostaglandin I2 (prostacyclin) receptor (IP); prostanoid IP receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 86,707,690 - 86,710,073 (+) NCBI GRCr8 mRatBN7.2 1 77,579,596 - 77,581,979 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 77,579,596 - 77,581,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 82,959,574 - 82,961,958 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 91,523,619 - 91,526,003 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 84,714,664 - 84,717,048 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 78,833,449 - 78,835,832 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 78,833,157 - 78,837,623 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 80,080,854 - 80,083,237 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 77,234,538 - 77,236,921 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 77,312,476 - 77,315,005 (+) NCBI Celera 1 72,064,851 - 72,067,234 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptgir Rat 1,2-dimethylhydrazine increases expression ISO Ptgir (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PTGIR mRNA CTD PMID:22206623 Ptgir Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGIR mRNA CTD PMID:32387183 and PMID:34747641 Ptgir Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTGIR mRNA CTD PMID:33387578 Ptgir Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PTGIR mRNA CTD PMID:25526689 Ptgir Rat 3',5'-cyclic AMP multiple interactions ISO PTGIR (Homo sapiens) 6480464 [cicaprost results in increased activity of PTGIR protein] which results in increased abundance of Cyclic AMP and GNAS protein promotes the reaction [[cicaprost results in increased activity of PTGIR protein] which results in increased abundance of Cyclic AMP] CTD PMID:11895442 Ptgir Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PTGIR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PTGIR mRNA more ... CTD PMID:28628672 Ptgir Rat 4,4'-sulfonyldiphenol multiple interactions ISO PTGIR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of PTGIR mRNA CTD PMID:28628672 Ptgir Rat acetylsalicylic acid affects response to substance ISO PTGIR (Homo sapiens) 6480464 PTGIR gene SNP affects the susceptibility to Aspirin CTD PMID:20485159 Ptgir Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PTGIR mRNA CTD PMID:16483693 Ptgir Rat antirheumatic drug decreases expression ISO PTGIR (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PTGIR mRNA CTD PMID:24449571 Ptgir Rat asbestos increases expression ISO PTGIR (Homo sapiens) 6480464 Asbestos results in increased expression of PTGIR mRNA CTD PMID:22398240 Ptgir Rat Azoxymethane multiple interactions ISO Ptgir (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIR mRNA CTD PMID:29950665 Ptgir Rat benzo[a]pyrene increases expression ISO Ptgir (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTGIR mRNA CTD PMID:22228805 Ptgir Rat beraprost multiple interactions ISO PTGIR (Homo sapiens) 6480464 beraprost binds to and results in increased activity of PTGIR protein and Endocannabinoids inhibits the reaction [beraprost binds to and results in increased activity of PTGIR protein] CTD PMID:30102254 Ptgir Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTGIR mRNA CTD PMID:25181051 Ptgir Rat bisphenol F multiple interactions ISO PTGIR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PTGIR mRNA CTD PMID:28628672 Ptgir Rat buta-1,3-diene decreases expression ISO Ptgir (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PTGIR mRNA CTD PMID:29038090 Ptgir Rat butanal increases expression ISO PTGIR (Homo sapiens) 6480464 butyraldehyde results in increased expression of PTGIR mRNA CTD PMID:26079696 Ptgir Rat calcium atom multiple interactions ISO PTGIR (Homo sapiens) 6480464 [cicaprost results in increased activity of PTGIR protein] which results in increased abundance of Calcium CTD PMID:11895442 Ptgir Rat calcium(0) multiple interactions ISO PTGIR (Homo sapiens) 6480464 [cicaprost results in increased activity of PTGIR protein] which results in increased abundance of Calcium CTD PMID:11895442 Ptgir Rat cannabidiol increases expression ISO Ptgir (Mus musculus) 6480464 Cannabidiol results in increased expression of PTGIR mRNA CTD PMID:21542829 Ptgir Rat capsaicin increases response to substance ISO Ptgir (Mus musculus) 6480464 PTGIR results in increased susceptibility to Capsaicin CTD PMID:15985616 Ptgir Rat Carbaprostacyclin multiple interactions ISO Ptgir (Mus musculus) 6480464 PTGIR protein affects the reaction [carboprostacyclin affects the reaction [Zymosan results in increased expression of IL10 mRNA]] more ... CTD PMID:11301049 Ptgir Rat carbon nanotube increases expression ISO PTGIR (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of PTGIR mRNA CTD PMID:15585362 Ptgir Rat carbon nanotube increases expression ISO Ptgir (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ptgir Rat carbon nanotube affects expression ISO Ptgir (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PTGIR mRNA CTD PMID:23845593 Ptgir Rat chloroprene decreases expression ISO Ptgir (Mus musculus) 6480464 Chloroprene results in decreased expression of PTGIR mRNA CTD PMID:23125180 Ptgir Rat choline multiple interactions ISO Ptgir (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PTGIR mRNA CTD PMID:20938992 Ptgir Rat cicaprost multiple interactions ISO PTGIR (Homo sapiens) 6480464 [cicaprost results in increased activity of PTGIR protein] which results in increased abundance of Calcium more ... CTD PMID:11895442 Ptgir Rat cicaprost affects localization ISO PTGIR (Homo sapiens) 6480464 cicaprost affects the localization of PTGIR protein CTD PMID:11895442 Ptgir Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of PTGIR mRNA CTD PMID:11328961 Ptgir Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of PTGIR mRNA CTD PMID:27523638 Ptgir Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PTGIR mRNA CTD PMID:26577399 Ptgir Rat dexamethasone multiple interactions ISO PTGIR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PTGIR mRNA more ... CTD PMID:28628672 Ptgir Rat dextran sulfate multiple interactions ISO Ptgir (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIR mRNA CTD PMID:29950665 Ptgir Rat Dibutyl phosphate affects expression ISO PTGIR (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PTGIR mRNA CTD PMID:37042841 Ptgir Rat dioxygen multiple interactions ISO Ptgir (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PTGIR mRNA CTD PMID:30529165 Ptgir Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PTGIR mRNA CTD PMID:29391264 Ptgir Rat folic acid multiple interactions ISO Ptgir (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PTGIR mRNA CTD PMID:20938992 Ptgir Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PTGIR mRNA CTD PMID:33387578 Ptgir Rat hypochlorous acid increases expression ISO Ptgir (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of PTGIR mRNA CTD PMID:19376150 Ptgir Rat iloprost affects binding ISO PTGIR (Homo sapiens) 6480464 Iloprost binds to PTGIR protein CTD PMID:11895442 Ptgir Rat indometacin multiple interactions ISO PTGIR (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PTGIR mRNA more ... CTD PMID:28628672 Ptgir Rat L-methionine multiple interactions ISO Ptgir (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PTGIR mRNA CTD PMID:20938992 Ptgir Rat lipopolysaccharide increases expression ISO PTGIR (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of PTGIR mRNA CTD PMID:35811015 Ptgir Rat lipopolysaccharide multiple interactions ISO PTGIR (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of PTGIR mRNA] CTD PMID:35811015 Ptgir Rat mevalonolactone affects binding ISO PTGIR (Homo sapiens) 6480464 mevalonolactone binds to PTGIR protein CTD PMID:11895442 Ptgir Rat mifepristone increases expression ISO PTGIR (Homo sapiens) 6480464 Mifepristone results in increased expression of PTGIR mRNA CTD PMID:17584828 Ptgir Rat N-methyl-4-phenylpyridinium increases expression ISO Ptgir (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PTGIR mRNA CTD PMID:22776087 Ptgir Rat N-methyl-4-phenylpyridinium increases expression ISO PTGIR (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PTGIR mRNA CTD PMID:24810058 Ptgir Rat nickel atom increases expression ISO PTGIR (Homo sapiens) 6480464 Nickel results in increased expression of PTGIR mRNA CTD PMID:24768652 and PMID:25583101 Ptgir Rat Nor-9-carboxy-delta9-THC multiple interactions ISO PTGIR (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of PTGIR gene CTD PMID:30521419 Ptgir Rat paracetamol affects expression ISO Ptgir (Mus musculus) 6480464 Acetaminophen affects the expression of PTGIR mRNA CTD PMID:17562736 Ptgir Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PTGIR mRNA CTD PMID:33387578 Ptgir Rat pentanal increases expression ISO PTGIR (Homo sapiens) 6480464 pentanal results in increased expression of PTGIR mRNA CTD PMID:26079696 Ptgir Rat propanal increases expression ISO PTGIR (Homo sapiens) 6480464 propionaldehyde results in increased expression of PTGIR mRNA CTD PMID:26079696 Ptgir Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PTGIR (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of PTGIR mRNA] CTD PMID:35811015 Ptgir Rat silicon dioxide increases expression ISO PTGIR (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PTGIR mRNA CTD PMID:25895662 Ptgir Rat silicon dioxide increases expression ISO Ptgir (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PTGIR mRNA CTD PMID:29203145 Ptgir Rat sodium arsenite increases expression ISO Ptgir (Mus musculus) 6480464 sodium arsenite results in increased expression of PTGIR mRNA CTD PMID:16014739 Ptgir Rat sotorasib multiple interactions ISO PTGIR (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of PTGIR mRNA CTD PMID:36139627 Ptgir Rat succimer multiple interactions ISO Ptgir (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of PTGIR mRNA CTD PMID:21641980 Ptgir Rat Theaflavin 3,3'-digallate affects expression ISO PTGIR (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of PTGIR mRNA CTD PMID:34925699 Ptgir Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PTGIR mRNA CTD PMID:34492290 Ptgir Rat titanium dioxide increases expression ISO Ptgir (Mus musculus) 6480464 titanium dioxide results in increased expression of PTGIR mRNA CTD PMID:23557971 Ptgir Rat titanium dioxide increases methylation ISO Ptgir (Mus musculus) 6480464 titanium dioxide results in increased methylation of PTGIR gene CTD PMID:35295148 Ptgir Rat titanium dioxide multiple interactions ISO Ptgir (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIR mRNA CTD PMID:29950665 Ptgir Rat titanium dioxide decreases expression ISO Ptgir (Mus musculus) 6480464 titanium dioxide results in decreased expression of PTGIR mRNA CTD PMID:29264374 Ptgir Rat trametinib multiple interactions ISO PTGIR (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of PTGIR mRNA CTD PMID:36139627 Ptgir Rat triphenyl phosphate affects expression ISO PTGIR (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PTGIR mRNA CTD PMID:37042841 Ptgir Rat triptonide increases expression ISO Ptgir (Mus musculus) 6480464 triptonide results in increased expression of PTGIR mRNA CTD PMID:33045310 Ptgir Rat valproic acid increases methylation ISO PTGIR (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PTGIR gene CTD PMID:29154799
Imported Annotations - SMPDB
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (EXP) 3',5'-cyclic AMP (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acetylsalicylic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) asbestos (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beraprost (ISO) bisphenol A (EXP) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (ISO) capsaicin (ISO) Carbaprostacyclin (ISO) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) cicaprost (ISO) clofibrate (EXP) Cuprizon (EXP) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) endosulfan (EXP) folic acid (ISO) gentamycin (EXP) hypochlorous acid (ISO) iloprost (ISO) indometacin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) mevalonolactone (ISO) mifepristone (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) Nor-9-carboxy-delta9-THC (ISO) paracetamol (EXP,ISO) pentanal (ISO) propanal (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sotorasib (ISO) succimer (ISO) Theaflavin 3,3'-digallate (ISO) thioacetamide (EXP) titanium dioxide (ISO) trametinib (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO)
Ptgir Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 86,707,690 - 86,710,073 (+) NCBI GRCr8 mRatBN7.2 1 77,579,596 - 77,581,979 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 77,579,596 - 77,581,979 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 82,959,574 - 82,961,958 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 91,523,619 - 91,526,003 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 84,714,664 - 84,717,048 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 78,833,449 - 78,835,832 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 78,833,157 - 78,837,623 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 80,080,854 - 80,083,237 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 77,234,538 - 77,236,921 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 77,312,476 - 77,315,005 (+) NCBI Celera 1 72,064,851 - 72,067,234 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
PTGIR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 46,610,687 - 46,625,089 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 46,618,550 - 46,625,089 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 47,123,725 - 47,128,346 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 51,815,565 - 51,820,194 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 51,815,565 - 51,820,194 NCBI Celera 19 43,927,252 - 43,931,881 (-) NCBI Celera Cytogenetic Map 19 q13.32 NCBI HuRef 19 43,548,741 - 43,553,370 (-) NCBI HuRef CHM1_1 19 47,125,572 - 47,130,201 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 49,436,301 - 49,450,683 (-) NCBI T2T-CHM13v2.0
Ptgir Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 16,640,442 - 16,644,828 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 16,640,415 - 16,644,830 (+) Ensembl GRCm39 Ensembl GRCm38 7 16,906,490 - 16,910,905 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 16,906,490 - 16,910,905 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 17,491,839 - 17,496,254 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 16,065,012 - 16,069,427 (+) NCBI MGSCv36 mm8 Celera 7 14,112,908 - 14,117,323 (+) NCBI Celera Cytogenetic Map 7 A2 NCBI cM Map 7 9.15 NCBI
Ptgir Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955574 687,583 - 689,750 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955574 686,156 - 690,126 (-) NCBI ChiLan1.0 ChiLan1.0
PTGIR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 52,770,490 - 52,775,153 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 54,641,304 - 54,645,928 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 43,613,065 - 43,617,700 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 52,141,822 - 52,146,473 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 52,141,822 - 52,146,473 (-) Ensembl panpan1.1 panPan2
PTGIR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 109,275,198 - 109,279,463 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 109,274,988 - 109,277,584 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 108,754,493 - 108,758,755 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 109,801,203 - 109,805,465 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 109,801,007 - 109,805,132 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 109,478,359 - 109,480,898 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 109,112,477 - 109,116,738 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 109,981,209 - 109,985,471 (+) NCBI UU_Cfam_GSD_1.0
Ptgir
PTGIR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 52,522,638 - 52,527,345 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 52,522,639 - 52,527,338 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 47,842,083 - 47,847,155 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTGIR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 39,977,057 - 39,983,592 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 39,977,864 - 39,980,860 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 19,689,063 - 19,693,721 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptgir
.
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 94 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000022461 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022461 ⟹ ENSRNOP00000022461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 77,579,596 - 77,581,979 (+) Ensembl Rnor_6.0 Ensembl 1 78,833,157 - 78,837,623 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100532 ⟹ ENSRNOP00000089168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 77,579,678 - 77,581,979 (+) Ensembl
RefSeq Acc Id:
NM_001077644 ⟹ NP_001071112
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 86,707,690 - 86,710,073 (+) NCBI mRatBN7.2 1 77,579,596 - 77,581,979 (+) NCBI Rnor_6.0 1 78,833,449 - 78,835,832 (+) NCBI Rnor_5.0 1 80,080,854 - 80,083,237 (+) NCBI RGSC_v3.4 1 77,234,538 - 77,236,921 (+) RGD Celera 1 72,064,851 - 72,067,234 (+) RGD
Sequence:
CTGGAGAAGACGGAAACAAAAGACAGAAACACACGCACACGGGGAACTGGGAGTTGACTGGCAGATCCCAGCTGCCCTGAGGATGGTGGCCAGCGGTGGACGTCCTGATGGTCCCCCTTCTATCACCC
hide sequence
RefSeq Acc Id:
NP_001071112 ⟸ NM_001077644
- UniProtKB:
P43253 (UniProtKB/Swiss-Prot), A6J8D9 (UniProtKB/TrEMBL)
- Sequence:
MVASGGRPDGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNGLALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAM
hide sequence
Ensembl Acc Id:
ENSRNOP00000022461 ⟸ ENSRNOT00000022461
Ensembl Acc Id:
ENSRNOP00000089168 ⟸ ENSRNOT00000100532
RGD ID: 13689744 Promoter ID: EPDNEW_R268 Type: initiation region Name: Ptgir_1 Description: prostaglandin I2 receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 78,833,234 - 78,833,294 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-08-22
Ptgir
prostaglandin I2 receptor
Ptgir
prostaglandin I2 (prostacyclin) receptor (IP)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-23
Ptgir
prostaglandin I2 (prostacyclin) receptor (IP)
Ptgir
prostaglandin I2 (prostacyclin) receptor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Ptgir
prostaglandin I2 (prostacyclin) receptor
Ptgir
prostaglandin I receptor (IP)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Ptgir
prostaglandin I receptor (IP)
Ptgir_predicted
prostaglandin I receptor (IP) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Ptgir_predicted
prostaglandin I receptor (IP) (predicted)
Symbol and Name status set to approved
70820 APPROVED
