Advanced Search (OLGA)

Gene: Chchd4 (coiled-coil-helix-coiled-coil-helix domain containing 4) Rattus norvegicus

Analyze

Symbol:

Chchd4

Name:

coiled-coil-helix-coiled-coil-helix domain containing 4

RGD ID:

1310746

Description:

Predicted to enable protein-disulfide reductase activity. Predicted to be involved in mitochondrial disulfide relay system and mitochondrial respiratory chain complex assembly. Predicted to act upstream of or within several processes, including cellular response to leukemia inhibitory factor; mitochondrial DNA repair; and regulation of protein export from nucleus. Predicted to be located in mitochondrion. Predicted to be active in mitochondrial intermembrane space. Orthologous to human CHCHD4 (coiled-coil-helix-coiled-coil-helix domain containing 4); PARTICIPATES IN intermembrane space assembly pathway of mitochondrial protein import; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

coiled-coil-helix-coiled-coil-helix domain-containing protein 4; LOC312559; MGC109542; mitochondrial intermembrane space import and assembly protein 40

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Chchd4-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	125,525,428 - 125,534,562 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	125,525,429 - 125,534,562 (-)	Ensembl				GRCr8
GRCr8 Ensembl	1	237,401,041 - 237,402,313 (+)	Ensembl				GRCr8
mRatBN7.2	4	123,968,264 - 123,977,398 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	227,987,570 - 227,988,844 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	4	123,968,265 - 123,977,414 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	129,434,271 - 129,443,386 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,208,699 - 125,217,814 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	123,833,253 - 123,842,368 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	123,108,924 - 123,118,186 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	123,108,925 - 123,118,186 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	187,427,514 - 187,436,776 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	125,647,269 - 125,656,403 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	112,887,725 - 112,896,859 (-)	NCBI		Celera
RGSC_v3.1	4	125,891,750 - 125,900,884 (-)	NCBI
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

choline (ISO)

copper(II) sulfate (ISO)

DDE (ISO)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

hydrogen peroxide (ISO)

L-methionine (ISO)

methidathion (ISO)

okadaic acid (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to leukemia inhibitory factor (ISO)

cellular response to oxidative stress (ISO)

establishment of protein localization to mitochondrion (IEA,ISO)

mitochondrial disulfide relay system (ISO,ISS)

mitochondrial DNA repair (ISO)

mitochondrial respiratory chain complex assembly (IEA,ISO,ISS)

positive regulation of cellular respiration (ISO)

protein import into mitochondrial intermembrane space (IBA,IEA)

protein maturation (IBA)

protein transport (IEA)

regulation of protein export from nucleus (ISO)

Cellular Component

mitochondrial intermembrane space (IBA,IEA,ISO,ISS)

mitochondrion (IEA,ISO,ISS)

Molecular Function

oxidoreductase activity (IEA)

protein binding (ISO)

protein-disulfide reductase activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

intermembrane space assembly pathway of mitochondrial protein import (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The MIA pathway: a key regulator of mitochondrial oxidative protein folding and biogenesis.	Mordas A and Tokatlidis K, Acc Chem Res. 2015 Aug 18;48(8):2191-9. doi: 10.1021/acs.accounts.5b00150. Epub 2015 Jul 27.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:16185709	PMID:18614015	PMID:19182799	PMID:20439489	PMID:21059946	PMID:23676665	PMID:24101517	PMID:26004228	PMID:26387864	PMID:37438854

Genomics

Comparative Map Data

Chchd4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	125,525,428 - 125,534,562 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	125,525,429 - 125,534,562 (-)	Ensembl				GRCr8
GRCr8 Ensembl	1	237,401,041 - 237,402,313 (+)	Ensembl				GRCr8
mRatBN7.2	4	123,968,264 - 123,977,398 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	227,987,570 - 227,988,844 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	4	123,968,265 - 123,977,414 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	129,434,271 - 129,443,386 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	125,208,699 - 125,217,814 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	123,833,253 - 123,842,368 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	123,108,924 - 123,118,186 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	123,108,925 - 123,118,186 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	187,427,514 - 187,436,776 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	125,647,269 - 125,656,403 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	112,887,725 - 112,896,859 (-)	NCBI		Celera
RGSC_v3.1	4	125,891,750 - 125,900,884 (-)	NCBI
Cytogenetic Map	4	q34	NCBI

CHCHD4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	14,112,077 - 14,124,870 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	14,112,077 - 14,124,876 (-)	Ensembl			hg38	GRCh38
GRCh37	3	14,153,577 - 14,166,370 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	14,128,578 - 14,141,372 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	14,128,583 - 14,141,323	NCBI
Celera	3	14,091,884 - 14,104,678 (-)	NCBI		Celera
Cytogenetic Map	3	p25.1	NCBI
HuRef	3	14,088,553 - 14,101,347 (-)	NCBI		HuRef
CHM1_1	3	14,103,963 - 14,116,757 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	14,114,022 - 14,126,815 (-)	NCBI		T2T-CHM13v2.0

Chchd4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	91,441,258 - 91,450,405 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	91,439,154 - 91,450,528 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	91,464,276 - 91,473,423 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	91,462,172 - 91,473,546 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	91,414,270 - 91,423,417 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	91,429,780 - 91,438,927 (-)	NCBI		MGSCv36	mm8
Celera	6	93,357,108 - 93,366,702 (-)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI
cM Map	6	40.53	NCBI

Chchd4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	16,912,208 - 16,921,157 (-)	Ensembl
ChiLan1.0	NW_004955429	16,911,392 - 16,921,353 (-)	NCBI	ChiLan1.0	ChiLan1.0

CHCHD4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	14,089,669 - 14,102,395 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	14,094,431 - 14,107,161 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	14,030,410 - 14,043,233 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	14,370,854 - 14,383,660 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	14,370,854 - 14,383,660 (-)	Ensembl			panPan2	panpan1.1

CHCHD4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	4,268,670 - 4,281,624 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	4,267,683 - 4,281,549 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	4,306,467 - 4,319,538 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	4,289,982 - 4,302,985 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	4,289,990 - 4,302,989 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	4,009,488 - 4,022,490 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	4,331,824 - 4,344,777 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	4,296,145 - 4,309,187 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Chchd4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	18,813,433 - 18,817,243 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	93,123 - 95,810 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	93,126 - 99,695 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHCHD4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	70,417,326 - 70,428,922 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	70,417,326 - 70,428,923 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	77,875,900 - 77,887,497 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHCHD4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	50,055,130 - 50,067,917 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	50,054,007 - 50,067,940 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	116,427,703 - 116,440,514 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chchd4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624872	1,481,319 - 1,488,097 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624872	1,481,149 - 1,488,992 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Chchd4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	55,468,327 - 55,477,489 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Chchd4
77 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	382
Count of miRNA genes:	214
Interacting mature miRNAs:	247
Transcripts:	ENSRNOT00000038096
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	96731383	141731383	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	117737142	152833657	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	108206096	153206096	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	111383604	156383604	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	103834277	148834277	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	107346299	152346299	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	111383604	156383604	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	113634167	149763391	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	121020385	148834277	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
24	12	81	205	129	127	81	98	81	12	437	224	11	172	100	121	46	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220795	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000038096 ⟹ ENSRNOP00000038359

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	125,525,429 - 125,534,562 (-)	Ensembl
mRatBN7.2 Ensembl	4	123,968,269 - 123,977,414 (-)	Ensembl
Rnor_6.0 Ensembl	4	123,108,925 - 123,118,186 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116242 ⟹ ENSRNOP00000094363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	237,401,041 - 237,402,313 (+)	Ensembl
mRatBN7.2 Ensembl	1	227,987,570 - 227,988,844 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116715 ⟹ ENSRNOP00000098005

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	125,525,429 - 125,529,128 (-)	Ensembl
mRatBN7.2 Ensembl	4	123,968,265 - 123,971,964 (-)	Ensembl

RefSeq Acc Id:

NM_001013431 ⟹ NP_001013449

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	125,525,428 - 125,534,562 (-)	NCBI
mRatBN7.2	4	123,968,264 - 123,977,398 (-)	NCBI
Rnor_6.0	4	123,108,924 - 123,118,186 (-)	NCBI
Rnor_5.0	4	187,427,514 - 187,436,776 (+)	NCBI
RGSC_v3.4	4	125,647,269 - 125,656,403 (-)	RGD
Celera	4	112,887,725 - 112,896,859 (-)	RGD

Sequence:

show sequence

GCTTAGGACGAGCGGAGGCAGGCGCGCGGCGGGCAGGCCTGGAGGGGGCGGGTCCGTGTGGGCC
TCAGTGCCACCCGCCAGGCCTGAGAAGAGGCGAGGGAGGTCACAACGAGAAGGTGTAGCCGCTG
TAGCCGCGCCTGCTCCCTCTGCGAGCTGGGAACGTTGAGAACAACCATGTCCTACTGCCGGCAG
GAAGGGAAGGATCGGATCATATTTGTGACCAAAGAAGACCATGAAACTCCTAGCAGTGCTGAGC
TGGTGGCTGATGACCCCAATGATCCCTATGAAGAGCACGGGTTGATACTGCCTAATGGAGACAT
TAACTGGAATTGCCCATGTCTTGGGGGAATGGCCAGCGGCCCCTGTGGGGAGCAGTTCAAGTCT
GCCTTTTCCTGCTTCCACTACAGCACAGAGGATATCAAGGGATCAGACTGTATAGACCAGTTCC
GGGCCATGCAGGAATGCATGCAGAAATACCCAGACCTCTATCCCCAAGACGAGGAGGAGGAAGA
GGAGGCAAAGCCAGTGGAACCAGTGGAGGAAACGGCTGACACTAAGGCCTCTGCAGCCAAAGAG
CAGGGGGCAAGCTCCTGAAGGCCTCAGGCCCTGGCTGCCACTCACCATGGGACTTTCTATACAA
TGCCTTTTGGTCACCTCTGTGAAAGTTCTTTCCCTCTGTGCACTGTAATATACAAAATAACTTA
TTTTAATAATCAGGGGTCTTGGCTACTTGCCGTATACACTGAAGAAAAGGGGGTGTGTGCACCT
GTGTCCTGCATAAACCTGTCCTTAAACGTTAGGCCACTCCTGGATGTACTCTGTGATTGCCCTG
GATTTTGCCACTTTGAAATAATGTGCTGAGGCTTCTCAGCAACCAAAAGTTGTTACTCAGGAAA
GTTTACCGTGAGAAAGCTGATTTATTCTGGTCCATGGTATGTATTCCTTTTGGTAGATTTTTCA
CCTCTTGGGAAAATTAAGTAAGTAGATGCCAAAACTCTTAAGAGTAGGTCCATCCCTACTGGAA
GAGGCTGGTGGTCAGGTACTGGAGCTGGAGGATGAGGCTGCTGCCTCGTTCCTGACAGCTATGT
TTCTGTGTTTGCAGTCCAGGCTCCAGGGCCTACAGCTGCAGGGTGGGATTGGACTCTGTGACTC
CCAGTCCCTCCTAAGTGAAAGGAGAGGCTGGCTTTGCAGTTTATTGTTTTCCTGTTCTGAGAGC
CCTGGTTTGGGGCCCATGTTCACTCAGTTGTGATATTGAGGTGGGGACCTAGCTGCTTCCAGAG
CAGAAGCCAACAGAGGAATGTCTGAATGAAGTACTCAATTAAAGAGAAACAATTTCTATCTGAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013449	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91407	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038359
	ENSRNOP00000038359.4
	ENSRNOP00000094363.1
GenBank Protein	Q5BJN5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013449 ⟸ NM_001013431
- UniProtKB:	Q5BJN5 (UniProtKB/Swiss-Prot), A0A8I6AU06 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMASGPC GEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEEEEEEAKPVEPVEETADTK ASAAKEQGASS hide sequence

Ensembl Acc Id:

ENSRNOP00000038359 ⟸ ENSRNOT00000038096

Ensembl Acc Id:

ENSRNOP00000098005 ⟸ ENSRNOT00000116715

Ensembl Acc Id:

ENSRNOP00000094363 ⟸ ENSRNOT00000116242

Protein Domains

CHCH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJN5-F1-model_v2	AlphaFold	Q5BJN5	1-139	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693250

Promoter ID:

EPDNEW_R3774

Type:

initiation region

Name:

LOC100361898_1

Description:

coiled-coil-helix-coiled-coil-helix domain containing 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	123,118,195 - 123,118,255	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310746	AgrOrtholog
BioCyc Gene	G2FUF-43722	BioCyc
Ensembl Genes	ENSRNOG00000022466	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000069157	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000038096	ENTREZGENE
	ENSRNOT00000038096.5	UniProtKB/Swiss-Prot
	ENSRNOT00000116242.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.287.2900	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7324948	IMAGE-MGC_LOAD
InterPro	CHCH	UniProtKB/Swiss-Prot
	CHCHD4	UniProtKB/Swiss-Prot
KEGG Report	rno:312559	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109542	IMAGE-MGC_LOAD
NCBI Gene	312559	ENTREZGENE
PANTHER	MITOCHONDRIAL INTERMEMBRANE SPACE IMPORT AND ASSEMBLY PROTEIN 40	UniProtKB/Swiss-Prot
	PTHR21622	UniProtKB/Swiss-Prot
Pfam	CHCH	UniProtKB/Swiss-Prot
PhenoGen	Chchd4	PhenoGen
PROSITE	CHCH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000022466	RatGTEx
	ENSRNOG00000069157	RatGTEx
UniProt	A0A8I6AU06	ENTREZGENE, UniProtKB/TrEMBL
	MIA40_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Chchd4	coiled-coil-helix-coiled-coil-helix domain containing 4	Chchd4_predicted	coiled-coil-helix-coiled-coil-helix domain containing 4 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Chchd4_predicted	coiled-coil-helix-coiled-coil-helix domain containing 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations