Advanced Search (OLGA)

Gene: Mccc2 (methylcrotonyl-CoA carboxylase subunit 2) Rattus norvegicus

Analyze

Symbol:

Mccc2

Name:

methylcrotonyl-CoA carboxylase subunit 2

RGD ID:

1310279

Description:

Contributes to methylcrotonoyl-CoA carboxylase activity. Involved in coenzyme A metabolic process. Predicted to be located in mitochondrial matrix. Predicted to be part of methylcrotonoyl-CoA carboxylase complex. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in 3-methylcrotonyl-CoA carboxylase 2 deficiency and mitochondrial metabolism disease. Orthologous to human MCCC2 (methylcrotonyl-CoA carboxylase subunit 2); PARTICIPATES IN 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyisobutyric aciduria pathway; 3-methylcrotonyl CoA carboxylase 1 deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

3-methylcrotonyl-CoA carboxylase 2; 3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit; 3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta; LOC361884; MCCase subunit beta; methylcrotonoyl-CoA carboxylase 2; methylcrotonoyl-CoA carboxylase 2 (beta); methylcrotonoyl-CoA carboxylase beta chain, mitochondrial; methylcrotonoyl-Coenzyme A carboxylase 2 (beta)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mccc2 (methylcrotonoyl-Coenzyme A carboxylase 2 (beta))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mccc2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mccc2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mccc2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mccc2 (methylcrotonyl-CoA carboxylase subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mccc2 (methylcrotonoyl-Coenzyme A carboxylase 2 (beta))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MCCC2 (methylcrotonyl-CoA carboxylase subunit 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mccc2 (methylcrotonoyl-CoA carboxylase 2 (beta))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mccc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F02A9.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mccc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mccc2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,039,044 - 33,110,092 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	33,039,045 - 33,110,299 (-)	Ensembl				GRCr8
mRatBN7.2	2	31,304,927 - 31,375,978 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,304,932 - 31,375,972 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	38,383,154 - 38,454,061 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,477,507 - 36,548,413 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,270,308 - 31,341,430 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	30,175,017 - 30,246,028 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,175,018 - 30,246,010 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	49,333,901 - 49,404,647 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	30,961,607 - 31,032,883 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	27,327,945 - 27,397,754 (-)	NCBI		Celera
RGSC_v3.1	2	30,881,976 - 30,953,252 (-)	NCBI
Cytogenetic Map	2	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-methylcrotonyl-CoA carboxylase 2 deficiency (ISO)

3-methylcrotonyl-CoA carboxylase deficiency (ISO)

autism spectrum disorder (ISO)

genetic disease (ISO)

mitochondrial metabolism disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrabromodibenzodioxine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

5-fluorouracil (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

clopidogrel (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

folic acid (ISO)

formaldehyde (ISO)

genistein (EXP)

glafenine (EXP)

irinotecan (ISO)

isoprenaline (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (EXP)

methyl methanesulfonate (ISO)

methylparaben (ISO)

methylseleninic acid (ISO)

N-nitrosomorpholine (EXP)

nimesulide (EXP)

paracetamol (ISO)

paraquat (EXP)

phlorizin (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

troglitazone (ISO)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

coenzyme A metabolic process (IDA)

L-leucine catabolic process (IBA,IEA,ISO)

Cellular Component

methylcrotonoyl-CoA carboxylase complex (IBA,IEA,ISO,ISS)

mitochondrial matrix (IEA,ISO)

mitochondrion (IBA,IEA,ISO)

Molecular Function

ATP binding (IEA)

ligase activity (IEA)

methylcrotonoyl-CoA carboxylase activity (IBA,IDA,IEA,ISO,ISS)

nucleotide binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

maple syrup urine disease pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

propionic acidemia pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The molecular basis of 3-methylcrotonylglycinuria, a disorder of leucine catabolism.	Gallardo ME, etal., Am J Hum Genet. 2001 Feb;68(2):334-46. Epub 2001 Jan 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Simultaneous preparation of the three biotin-containing mitochondrial carboxylases from rat liver.	Oei J and Robinson BH, Biochim Biophys Acta. 1985 May 29;840(1):1-5.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14651853	PMID:16023992	PMID:17360195	PMID:18614015	PMID:26316108	PMID:31505169

Genomics

Comparative Map Data

Mccc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	33,039,044 - 33,110,092 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	33,039,045 - 33,110,299 (-)	Ensembl				GRCr8
mRatBN7.2	2	31,304,927 - 31,375,978 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	31,304,932 - 31,375,972 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	38,383,154 - 38,454,061 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	36,477,507 - 36,548,413 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	31,270,308 - 31,341,430 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	30,175,017 - 30,246,028 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	30,175,018 - 30,246,010 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	49,333,901 - 49,404,647 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	30,961,607 - 31,032,883 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	27,327,945 - 27,397,754 (-)	NCBI		Celera
RGSC_v3.1	2	30,881,976 - 30,953,252 (-)	NCBI
Cytogenetic Map	2	q12	NCBI

MCCC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	71,587,340 - 71,658,706 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	71,579,531 - 71,658,706 (+)	Ensembl			hg38	GRCh38
GRCh37	5	70,883,167 - 70,954,533 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	70,918,910 - 70,988,981 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	70,918,909 - 70,988,981	NCBI
Celera	5	66,778,848 - 66,850,229 (+)	NCBI		Celera
Cytogenetic Map	5	q13.2	NCBI
HuRef	5	66,088,903 - 66,160,527 (+)	NCBI		HuRef
CHM1_1	5	70,315,816 - 70,387,189 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	72,068,680 - 72,140,018 (+)	NCBI		T2T-CHM13v2.0

Mccc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	100,085,040 - 100,152,147 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	100,085,038 - 100,152,147 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	99,948,532 - 100,015,639 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	99,948,530 - 100,015,639 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	100,718,487 - 100,785,594 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	101,048,783 - 101,115,886 (-)	NCBI		MGSCv36	mm8
Celera	13	103,601,615 - 103,669,283 (-)	NCBI		Celera
Cytogenetic Map	13	D1	NCBI
cM Map	13	52.9	NCBI

Mccc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955575	445,619 - 505,040 (+)	Ensembl
ChiLan1.0	NW_004955575	445,627 - 503,891 (+)	NCBI	ChiLan1.0	ChiLan1.0

MCCC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	43,651,293 - 43,726,414 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	41,804,951 - 41,880,028 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	43,650,993 - 43,724,877 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	44,298,650 - 44,369,106 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	44,298,650 - 44,369,106 (-)	Ensembl			panPan2	panpan1.1

MCCC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	54,751,703 - 54,825,133 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	54,751,698 - 54,823,273 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	51,718,218 - 51,791,623 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	55,265,241 - 55,340,500 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	55,265,213 - 55,340,215 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	52,327,887 - 52,401,292 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	53,094,755 - 53,168,219 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	53,986,123 - 54,059,570 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mccc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	186,028,772 - 186,100,599 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936549	4,755,546 - 4,830,242 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936549	4,760,073 - 4,830,190 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MCCC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	47,917,291 - 47,996,534 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	47,917,308 - 47,996,540 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	51,863,689 - 51,939,708 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MCCC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	65,944,742 - 66,013,663 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	65,944,840 - 66,013,663 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	14,689,886 - 14,759,320 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mccc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624905	645,715 - 712,364 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624905	645,782 - 709,611 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mccc2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	196,590,311 - 196,657,303 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mccc2
613 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	178
Count of miRNA genes:	137
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000023900
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	13325041	58325041	Rat
7387318	Stl32	Serum triglyceride level QTL 32	3.2	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	24117813	69117813	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1579916	Bp270	Blood pressure QTL 270		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	16051883	61051883	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	22038044	67038044	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	28889991	73889991	Rat
1331764	Bp205	Blood pressure QTL 205	3.476		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	14368707	59368707	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	83465677	Rat
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	18227137	63227137	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	28652666	73652666	Rat

Markers in Region

RH131089

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	31,305,061 - 31,305,249 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,175,148 - 30,175,335	NCBI	Rnor6.0
Rnor_5.0	2	49,334,031 - 49,334,218	UniSTS	Rnor5.0
RGSC_v3.4	2	30,961,737 - 30,961,924	UniSTS	RGSC3.4
Celera	2	27,328,075 - 27,328,262	UniSTS
RH 3.4 Map	2	63.2	UniSTS
Cytogenetic Map	2	q12	UniSTS

AU049737

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	31,350,338 - 31,350,565 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	30,220,271 - 30,220,497	NCBI	Rnor6.0
Rnor_5.0	2	49,379,001 - 49,379,227	UniSTS	Rnor5.0
RGSC_v3.4	2	31,007,101 - 31,007,327	UniSTS	RGSC3.4
Celera	2	27,372,891 - 27,373,117	UniSTS
Cytogenetic Map	2	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	91	59	6	355	191	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023900 ⟹ ENSRNOP00000023900

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,039,045 - 33,110,299 (-)	Ensembl
mRatBN7.2 Ensembl	2	31,304,933 - 31,375,957 (-)	Ensembl
Rnor_6.0 Ensembl	2	30,175,018 - 30,246,010 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076389

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,044,069 - 33,110,068 (-)	Ensembl
mRatBN7.2 Ensembl	2	31,304,932 - 31,375,972 (-)	Ensembl
Rnor_6.0 Ensembl	2	30,175,213 - 30,187,700 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096471 ⟹ ENSRNOP00000077574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	31,305,117 - 31,375,972 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108332 ⟹ ENSRNOP00000081925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,039,045 - 33,110,068 (-)	Ensembl
mRatBN7.2 Ensembl	2	31,304,933 - 31,375,957 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109895 ⟹ ENSRNOP00000083912

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	33,039,045 - 33,110,227 (-)	Ensembl
mRatBN7.2 Ensembl	2	31,304,933 - 31,375,957 (-)	Ensembl

RefSeq Acc Id:

NM_001012177 ⟹ NP_001012177

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,039,044 - 33,110,068 (-)	NCBI
mRatBN7.2	2	31,304,932 - 31,375,957 (-)	NCBI
Rnor_6.0	2	30,175,018 - 30,246,010 (-)	NCBI
Rnor_5.0	2	49,333,901 - 49,404,647 (-)	NCBI
RGSC_v3.4	2	30,961,607 - 31,032,883 (-)	RGD
Celera	2	27,327,945 - 27,397,754 (-)	RGD

Sequence:

show sequence

CTGGCCTGGGAGCTTGGTGGACCAAGGCTGGTGGTGCAAGAATTCTGGAGGAACAGCGGCCCGG
AGCTGCAAAACTCAGCTGCAGGGCCGCTCTCTCTCTTTCTCTCTCTCTCTTTCTCTTGGGTGCT
TGCTATCGCCATGTGGGGCGCGCTGAGGTCAGTTCTGCGGCCCTGCAGTCGGGCCTCCGTACCC
CGGCAGCGCGCCTATCACGGGGACGCGGTGGCCCGACTGGGCACCCAGCCTGACTCGGGCTCCT
CCACCTACCAGGAGAACTATGAGCAGATGAAAGCTTTAGTGAATCAACTTCATGAACGAGCCCA
GTATGTAAGACTGGGAGGGAGTGAGAAAGCCCGGGCGCGACACACATCAAGAGGAAAACTGTTA
CCCAGAGACCGAATCGACAACCTCATAGACCCAGGGTCTCCCTTTCTGGAATTCTCCCAGTTCG
CAGGTTACAAGTTATATGGCGAGGAGGAAGTCCCTGCAGGTGGCATCATCACAGGCATTGGGCG
AGTGTCTGGAGTAGAATGCATGATTGTGGCTAACGATGCCACCGTCAAAGGAGGCACCTACTAC
CCAGTGACGGTGAAAAAGCACGTTCGGGCACAAGAGATCGCACTGCAGAACAGGCTCCCATGCA
TCTATCTGGTTGACTCAGGAGGGGCCAACTTACCTCGGCAAGCAGACACCTTTCCAGACCGGGA
CCACTTTGGCCGCATATTCTATAATCAAGCTATTATGTCTTCTAAAAATATCACACAGATAGCT
GTGGTCATGGGCTCCTGTACGGCAGGAGGTGCATATGTGCCGGCCATGGCTGATGAAAACATCA
TTGTACAAAGACAGGGTACTATCTTCTTGGCTGGACCACCCTTGGTGAAGGCAGCTACCGGCGA
AGAGGTGTCCGCTGAGGATCTCGGAGGTGCTGACTTGCACTGCAGAAGGTCTGGGGTCACTGAC
CACTATGCTTTGGATGACCACCACGCCCTTCACTTGACAAGGAAGGTTGTGAGGAGTCTCAATT
ATCAGAAGAAACTGGATGTTACCGTTGAACCTTCTGAAGAGCCCTTGTTCCCCGCAGATGAATT
GTATGGGATAGTCGGTGCGAACCTTAAGAGGAGCTTTGATGTCCGAGAGGTCATTGCTAGAATC
GTCGATGGAAGCAGATTCAATGAGTTCAAGGCCTTGTATGGAGACACGCTCGTCACAGGATTCG
CTCGAATATTTGGGTACCCAGTAGGCATCATTGGAAACAATGGAGTTTTGTTTTCTGAATCTGC
CAAAAAGGGCGCTCACTTCGTCCAGCTGTGCTGCCAAAGAAATATCCCCCTGCTGTTTCTCCAG
AACATCACTGGATTCATGGTTGGTAAAGACTATGAAGCCGAAGGGATTGCCAAGGATGGCGCCA
AGATGGTAGCCGCAGTATCCTGTGCCAAAGTGCCTAAGATAACTGTCATAATCGGGGGATCATA
TGGGGCTGGAAACTACGGAATGTGTGGCAGAGCATATAGTCCAAGATTTCTCTACATGTGGCCA
AATGCTCGCATCTCAGTGATGGGAGGAGAGCAGGCAGCCACCGTGTTAGCCACGGTGGCGAGAG
ACCAGAGAGCCCGTGAGGGGAAGCAGTTCTCCAGTGCAGAGGAGGCAGCTTTGAAAGAGCCCAT
CATCAAGAGGTTCGAAGAGGAAGGGAACCCTTACTATTCCAGTGCAAGGCTGTGGGATGATGGG
ATTATCGACCCCGTGGACACCAGGCTGGTTCTGGGACTCAGCATCAGTGCAGCCCTCAATGCGC
CCATCCAGAGGACAGACTTTGGCATCTTCAGGATGTAACCCAGATACGGAACGTGTTGCCACAG
CTGTAATAAAAATTAACACGTGTGACTAGCCTTAAAACTTGAGATCCACTGGGCATTTGCTGGC
ACAGGAATTCTTTTCTTAACAGTATGATGTATGGGTTTTTTTTTTTTTAATTGTAAAAATCAGT
GAGTATTCTGCTTGATGAGCTTTGATTTGTCAAAAATTTTTCTTACAGACACTTCTCATGGCTC
ATTTTTTACCACCCATAAAATGAAGTGACCGATTTTGCAATTATCCTTTTGAGAACCACAAACA
GTTTGAAAAATAAATCTCTCTAATCTATGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102544 ⟹ XP_038958472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,039,044 - 33,110,092 (-)	NCBI
mRatBN7.2	2	31,304,927 - 31,375,978 (-)	NCBI

RefSeq Acc Id:

XM_039102546 ⟹ XP_038958474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	33,042,885 - 33,110,092 (-)	NCBI
mRatBN7.2	2	31,310,396 - 31,375,978 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001012177	(Get FASTA)	NCBI Sequence Viewer
	XP_038958472	(Get FASTA)	NCBI Sequence Viewer
	XP_038958474	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83581	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023900
	ENSRNOP00000023900.4
GenBank Protein	Q5XIT9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012177 ⟸ NM_001012177

- UniProtKB:

Q5XIT9 (UniProtKB/Swiss-Prot), A0A8I5ZSP4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MWGALRSVLRPCSRASVPRQRAYHGDAVARLGTQPDSGSSTYQENYEQMKALVNQLHERAQYVR
LGGSEKARARHTSRGKLLPRDRIDNLIDPGSPFLEFSQFAGYKLYGEEEVPAGGIITGIGRVSG
VECMIVANDATVKGGTYYPVTVKKHVRAQEIALQNRLPCIYLVDSGGANLPRQADTFPDRDHFG
RIFYNQAIMSSKNITQIAVVMGSCTAGGAYVPAMADENIIVQRQGTIFLAGPPLVKAATGEEVS
AEDLGGADLHCRRSGVTDHYALDDHHALHLTRKVVRSLNYQKKLDVTVEPSEEPLFPADELYGI
VGANLKRSFDVREVIARIVDGSRFNEFKALYGDTLVTGFARIFGYPVGIIGNNGVLFSESAKKG
AHFVQLCCQRNIPLLFLQNITGFMVGKDYEAEGIAKDGAKMVAAVSCAKVPKITVIIGGSYGAG
NYGMCGRAYSPRFLYMWPNARISVMGGEQAATVLATVARDQRAREGKQFSSAEEAALKEPIIKR
FEEEGNPYYSSARLWDDGIIDPVDTRLVLGLSISAALNAPIQRTDFGIFRM

hide sequence

Ensembl Acc Id:

ENSRNOP00000023900 ⟸ ENSRNOT00000023900

RefSeq Acc Id:	XP_038958472 ⟸ XM_039102544
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A3M2 (UniProtKB/TrEMBL), A0A8I5ZSP4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958474 ⟸ XM_039102546
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZSP4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000081925 ⟸ ENSRNOT00000108332

Ensembl Acc Id:

ENSRNOP00000077574 ⟸ ENSRNOT00000096471

Ensembl Acc Id:

ENSRNOP00000083912 ⟸ ENSRNOT00000109895

Protein Domains

CoA carboxyltransferase C-terminal CoA carboxyltransferase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIT9-F1-model_v2	AlphaFold	Q5XIT9	1-563	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691100

Promoter ID:

EPDNEW_R1625

Type:

initiation region

Name:

Mccc2_1

Description:

methylcrotonoyl-CoA carboxylase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	30,245,994 - 30,246,054	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310279	AgrOrtholog
BioCyc Gene	G2FUF-54680	BioCyc
BioCyc Pathway	LEU-DEG2-PWY [L-leucine degradation I]	BioCyc
BioCyc Pathway Image	LEU-DEG2-PWY	BioCyc
Ensembl Genes	ENSRNOG00000017752	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023900	ENTREZGENE
	ENSRNOT00000023900.6	UniProtKB/Swiss-Prot
Gene3D-CATH	2-enoyl-CoA Hydratase, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7129446	IMAGE-MGC_LOAD
InterPro	AcCoA_carboxyl	UniProtKB/Swiss-Prot
	ClpP/crotonase-like_dom_sf	UniProtKB/Swiss-Prot
	COA_CT_C	UniProtKB/Swiss-Prot
	COA_CT_N	UniProtKB/Swiss-Prot
	MCCB/AccD1-like	UniProtKB/Swiss-Prot
KEGG Report	rno:361884	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94191	IMAGE-MGC_LOAD
NCBI Gene	361884	ENTREZGENE
PANTHER	METHYLCROTONOYL-COA CARBOXYLASE BETA CHAIN, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR22855	UniProtKB/Swiss-Prot
Pfam	Carboxyl_trans	UniProtKB/Swiss-Prot
PharmGKB	MCCC2	RGD
PhenoGen	Mccc2	PhenoGen
PROSITE	COA_CT_CTER	UniProtKB/Swiss-Prot
	COA_CT_NTER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017752	RatGTEx
Superfamily-SCOP	SSF52096	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZSP4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A3M2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G9M3_RAT	UniProtKB/TrEMBL
	MCCB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-26	Mccc2	methylcrotonyl-CoA carboxylase subunit 2	Mccc2	methylcrotonoyl-CoA carboxylase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-12-10	Mccc2	methylcrotonoyl-CoA carboxylase 2	Mccc2	methylcrotonoyl-CoA carboxylase 2 (beta)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Mccc2	methylcrotonoyl-CoA carboxylase 2 (beta)	Mccc2	methylcrotonoyl-Coenzyme A carboxylase 2 (beta)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Mccc2	methylcrotonoyl-Coenzyme A carboxylase 2 (beta)	Mccc2_predicted	methylcrotonoyl-Coenzyme A carboxylase 2 (beta) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Mccc2_predicted	methylcrotonoyl-Coenzyme A carboxylase 2 (beta) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways