Cmpk1 (cytidine/uridine monophosphate kinase 1)

Advanced Search (OLGA)

Gene: Cmpk1 (cytidine/uridine monophosphate kinase 1) Rattus norvegicus

Analyze

Symbol:

Cmpk1

Name:

cytidine/uridine monophosphate kinase 1

RGD ID:

1310116

Description:

Enables CMP kinase activity; UMP kinase activity; and dUMP kinase activity. Involved in ovulation cycle process; phthalate metabolic process; and pyrimidine nucleoside diphosphate biosynthetic process. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma. Orthologous to human CMPK1 (cytidine/uridine monophosphate kinase 1); PARTICIPATES IN de novo pyrimidine biosynthetic pathway; gemcitabine pharmacodynamics pathway; gemcitabine pharmacokinetics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CK; Cmpk; cytidine monophosphate (UMP-CMP) kinase 1; cytidine monophosphate (UMP-CMP) kinase 1, cytosolic; cytidine monophosphate kinase; cytidylate kinase; dCMP kinase; deoxycytidylate kinase; LOC298410; MGC112719; nucleoside-diphosphate kinase; RGD1310116; similar to UMP-CMP kinase; UMP-CMP kinase; UMP-CMP kinase 1; UMP/CMP kinase; UMP/CMPK; uridine monophosphate kinase; uridine monophosphate/cytidine monophosphate kinase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CMPK1 (cytidine/uridine monophosphate kinase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cmpk1 (cytidine/uridine monophosphate kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CMPK1 (cytidine/uridine monophosphate kinase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cmpk (cytidylate kinase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	URA6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	URA6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C29F7.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dak1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F40F8.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cmpk1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cmpk1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,717,073 - 133,744,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	133,717,086 - 133,744,596 (-)	Ensembl				GRCr8
mRatBN7.2	5	128,480,301 - 128,507,830 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,480,301 - 128,507,830 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	131,169,403 - 131,196,989 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,899,052 - 132,926,636 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,920,733 - 132,948,328 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,759,722 - 133,786,452 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,759,735 - 133,786,452 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	137,551,825 - 137,578,247 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	135,320,845 - 135,348,973 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	127,132,281 - 127,159,748 (-)	NCBI		Celera
RGSC_v3.1	5	135,326,070 - 135,354,120 (-)	NCBI
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

lung non-small cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-citrinin (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,6-dimethoxyphenol (ISO)

2-methylcholine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (EXP)

aristolochic acid A (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cidofovir anhydrous (ISO)

clofibrate (EXP)

clofibric acid (EXP)

dextran sulfate (ISO)

dicrotophos (ISO)

fenthion (ISO)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

ivermectin (ISO)

L-ethionine (EXP)

lead(0) (ISO)

methidathion (ISO)

nitrates (ISO)

ochratoxin A (ISO)

omeprazole (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

phenytoin (EXP)

pirinixic acid (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' pyrimidine nucleobase biosynthetic process (IEA)

CDP biosynthetic process (IBA)

dCDP biosynthetic process (IDA)

dUDP biosynthetic process (IDA)

nucleobase-containing compound metabolic process (IEA)

nucleoside monophosphate metabolic process (IEA)

nucleoside monophosphate phosphorylation (IEA)

nucleotide biosynthetic process (IEA)

ovulation cycle process (IEP)

phthalate metabolic process (IEP)

pyrimidine nucleotide biosynthetic process (IEA)

pyrimidine-containing compound biosynthetic process (IEA)

ribonucleoside diphosphate biosynthetic process (IEA)

UDP biosynthetic process (IBA,IDA,IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA)

Molecular Function

ATP binding (IEA)

CMP kinase activity (IDA,IEA)

dCMP kinase activity (IEA)

dUMP kinase activity (IDA)

kinase activity (IEA)

nucleobase-containing compound kinase activity (IEA)

nucleoside diphosphate kinase activity (IEA,ISO,ISS)

nucleoside monophosphate kinase activity (IEA,ISO)

nucleotide binding (IEA)

phosphotransferase activity, phosphate group as acceptor (IEA)

protein binding (ISO)

transferase activity (IEA)

UMP kinase activity (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

de novo pyrimidine biosynthetic pathway (ISO)

gemcitabine pharmacodynamics pathway (ISO)

gemcitabine pharmacokinetics pathway (ISO)

Glut1 deficiency syndrome pathway (ISO)

lactose biosynthetic pathway (ISO)

lamivudine pharmacokinetics pathway (ISO)

pyrimidine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization of pyrimidine nucleoside monophosphokinase in normal and malignant tissues.	Arima T, etal., Cancer Res. 1977 Jun;37(6):1593-7.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Endocrine disrupting effect of di-(2-ethylhexyl)phthalate on female rats and proteome analyses of their pituitaries.	Hirosawa N, etal., Proteomics. 2006 Feb;6(3):958-71.
4.	De novo synthesis of pyrimidine nucleotides; emerging interfaces with signal transduction pathways.	Huang M and Graves LM, Cell Mol Life Sci. 2003 Feb;60(2):321-36.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Differential Effect of Polymorphisms of CMPK1 and RRM1 on Survival in Advanced Non-small Cell Lung Cancer Patients Treated with Gemcitabine or Taxane/Cisplatinum.	Ryu JS, etal., J Thorac Oncol. 2011 Jun 2.
12.	Pyrimidine nucleoside monophosphate kinase from rat bone marrow cells: chromatographic, electrophoretic, and sedimentation behavior of active and inactive enzyme forms.	Seagrave J and Reyes P, Arch Biochem Biophys. 1986 May 15;247(1):76-83.
13.	Up-regulated uridine kinase gene identified by RLCS in the ventral horn after crush injury to rat sciatic nerves.	Yuh I, etal., Biochem Biophys Res Commun 1999 Dec 9;266(1):104-9.

Additional References at PubMed

PMID:40615	PMID:11912132	PMID:12477932	PMID:19056867	PMID:22871113	PMID:23376485	PMID:23416111	PMID:23533145

Genomics

Comparative Map Data

Cmpk1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	133,717,073 - 133,744,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	133,717,086 - 133,744,596 (-)	Ensembl				GRCr8
mRatBN7.2	5	128,480,301 - 128,507,830 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,480,301 - 128,507,830 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	131,169,403 - 131,196,989 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	132,899,052 - 132,926,636 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	132,920,733 - 132,948,328 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	133,759,722 - 133,786,452 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	133,759,735 - 133,786,452 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	137,551,825 - 137,578,247 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	135,320,845 - 135,348,973 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	127,132,281 - 127,159,748 (-)	NCBI		Celera
RGSC_v3.1	5	135,326,070 - 135,354,120 (-)	NCBI
Cytogenetic Map	5	q35	NCBI

CMPK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	47,333,790 - 47,378,839 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	47,333,790 - 47,394,866 (+)	Ensembl			hg38	GRCh38
GRCh37	1	47,799,462 - 47,844,511 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	47,572,175 - 47,617,098 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	46,085,741 - 46,130,781 (+)	NCBI		Celera
Cytogenetic Map	1	p33	NCBI
HuRef	1	45,915,968 - 45,960,944 (+)	NCBI		HuRef
CHM1_1	1	47,916,317 - 47,961,359 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	47,212,232 - 47,257,303 (+)	NCBI		T2T-CHM13v2.0

Cmpk1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	114,817,810 - 114,844,425 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	114,816,533 - 114,844,438 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	114,960,613 - 114,987,228 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	114,959,336 - 114,987,241 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	114,633,218 - 114,659,833 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	114,458,570 - 114,485,076 (-)	NCBI		MGSCv36	mm8
Celera	4	113,708,548 - 113,734,653 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	52.73	NCBI

Cmpk1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	11,175,014 - 11,187,133 (-)	Ensembl
ChiLan1.0	NW_004955464	11,179,432 - 11,213,147 (-)	NCBI	ChiLan1.0	ChiLan1.0

CMPK1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	179,437,907 - 179,468,944 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	178,579,344 - 178,610,662 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	46,642,602 - 46,673,568 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	48,156,641 - 48,186,778 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	48,172,352 - 48,184,684 (+)	Ensembl			panPan2	panpan1.1

CMPK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	13,324,235 - 13,357,387 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	13,326,185 - 13,358,152 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	13,476,565 - 13,509,755 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	13,473,206 - 13,506,434 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	13,456,379 - 13,506,417 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	13,273,274 - 13,306,477 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	13,341,002 - 13,374,200 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	13,410,462 - 13,443,720 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cmpk1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	62,322,681 - 62,355,997 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	28,147,085 - 28,182,043 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	28,147,459 - 28,180,779 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CMPK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	164,162,518 - 164,197,379 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	164,161,439 - 164,197,429 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	151,714,202 - 151,748,280 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CMPK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	85,541,796 - 85,584,167 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	85,541,205 - 85,584,068 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	31,498,081 - 31,540,968 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cmpk1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624859	5,452,694 - 5,495,840 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cmpk1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	41,598,225 - 41,625,014 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cmpk1
115 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	100
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000010318
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133308734	140009902	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Rat30

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	133,736,491 - 133,736,653 (+)	Marker Load Pipeline
mRatBN7.2	5	128,499,722 - 128,499,884 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	133,778,372 - 133,778,531	NCBI	Rnor6.0
Rnor_5.0	5	137,570,167 - 137,570,326	UniSTS	Rnor5.0
RGSC_v3.4	5	135,340,721 - 135,340,881	RGD	RGSC3.4
RGSC_v3.4	5	135,340,722 - 135,340,881	UniSTS	RGSC3.4
Celera	5	127,151,674 - 127,151,833	UniSTS
RGSC_v3.1	5	135,345,948 - 135,346,107	RGD
RH 3.4 Map	5	829.5	UniSTS
RH 3.4 Map	5	829.5	RGD
RH 2.0 Map	5	795.7	RGD
SHRSP x BN Map	5	68.3799	RGD
Cytogenetic Map	5	q36	UniSTS

D5Got57

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	128,486,224 - 128,486,435 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	133,765,646 - 133,765,856	NCBI	Rnor6.0
Rnor_5.0	5	137,557,749 - 137,557,959	UniSTS	Rnor5.0
RGSC_v3.4	5	135,326,767 - 135,326,978	RGD	RGSC3.4
RGSC_v3.4	5	135,326,768 - 135,326,978	UniSTS	RGSC3.4
Celera	5	127,138,204 - 127,138,414	UniSTS
RGSC_v3.1	5	135,331,994 - 135,332,204	RGD
RH 3.4 Map	5	836.7	UniSTS
RH 3.4 Map	5	836.7	RGD
RH 2.0 Map	5	801.5	RGD
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287399	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010318 ⟹ ENSRNOP00000010318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	133,718,842 - 133,744,596 (-)	Ensembl
mRatBN7.2 Ensembl	5	128,482,070 - 128,507,830 (-)	Ensembl
Rnor_6.0 Ensembl	5	133,759,735 - 133,786,452 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081051 ⟹ ENSRNOP00000068780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	133,717,086 - 133,744,596 (-)	Ensembl
mRatBN7.2 Ensembl	5	128,480,301 - 128,507,830 (-)	Ensembl
Rnor_6.0 Ensembl	5	133,759,750 - 133,786,403 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104723 ⟹ ENSRNOP00000095458

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	133,718,796 - 133,744,596 (-)	Ensembl
mRatBN7.2 Ensembl	5	128,480,301 - 128,507,752 (-)	Ensembl

RefSeq Acc Id:

NM_001025655 ⟹ NP_001020826

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	133,717,073 - 133,744,596 (-)	NCBI
mRatBN7.2	5	128,480,301 - 128,507,830 (-)	NCBI
Rnor_6.0	5	133,759,722 - 133,786,452 (-)	NCBI
Rnor_5.0	5	137,551,825 - 137,578,247 (-)	NCBI
RGSC_v3.4	5	135,320,845 - 135,348,973 (-)	RGD
Celera	5	127,132,281 - 127,159,748 (-)	RGD

Sequence:

show sequence

CCGCAGCTGGCGGCGGGGCCCGGCGCCCGCTCAGCCCGCCCCCTCCCTGCCGCCCCGCCCGCGC
CACCGCGCCGGCCGCTGTCAGAGGCGCGTTGTATGCTGAGCAGCTGTCGTCGCTGGCTGCTGCA
CGTCCTGGTCCCGAGCTTCCCGCCGCTAACCCGCGGACTGCGGTTCTTCCCTCTCCAACTCATG
AAGCCGTTGGTCGTGTTCGTTTTGGGCGGGCCCGGTGCGGGCAAGGGGACCCAGTGCGCGCGCA
TTGTTGAGAAATATGGCTACACACACCTTTCTGCAGGAGAGCTTCTTCGTGATGAAAGGAAGAA
TCCAGATTCACAGTATGGTGAACTTATTGAAAAGTACATTAAAGAAGGAAAGATTGTACCAGTT
GAGATAACCATCAGTTTATTAAAGAGGGAAATGGACCAAACAATGGCTGCCAATGCTCAGAAGA
ATAAATTCTTGATTGATGGCTTTCCAAGAAATCAAGACAACCTTCAGGGTTGGAACAAGACCAT
GGATGGGAAAGCAGATGTATCTTTTGTTCTGTTTTTTGACTGTAATAATGAGATCTGTATTGAC
CGATGTCTTGAAAGGGGAAAAAGTAGTGGTAGGAGTGATGACAACAGAGAGAGCTTGGAAAAGA
GAATTCAGACTTATCTTGAATCAACAAAACCAATTATTGACCTATATGAAGAAATGGGCAAAGT
CAAGAAAATAGACGCTTCTAAGTCTGTTGATGAAGTTTTTGGTGACGTTATGAAGATTTTTGAC
AAAGAAGGCTAACTAACCCTGGGACATCTTTGAAATCATGCTTGAATATTGCTTTGATAGCTGC
TATCACAGCCCCCTTTTAAGGCAGTTTTAAGATTACATCTCAATTAATGTCTAGAAATATATAG
TAAGACAAATTATGTGTTTTTTAATTTGTGGTCACAGTGCACAGTGAATTCAGGTTTAAATCAT
TTTAGGTATTATGGTGCTCACAAAATGAAGAAGGGTATCAGCTAATTCTTGTCTGTGTTAAAAG
ACTATCCCCTTAATCCCTTTTATGTCTGTGCCTTCTGGGAGACAATTTCTTTTTAGTATGCATG
TGTATCCCTTTTGTAATTGCAGTGTGTTGGGATTTGGGATTTCCACTTCCTCTTACTGCACATT
TAAAATTTCCAACCTGCTAAGTGAATTTGTGGACCAAATTTAAAGGAACTTTATGTGTAGCTGG
TTCTTGCTCAAGGTGTTTAGTAAACAAACTCAGAAAATGGATTCCTAGCAATGTTCTATTTATC
AGATGACTGACCATTTCCTGTCGAAAGTTAAAACGTAGAGATTGATTTACTACAGCTTGTGCAA
AGTCTTTGTTCCAAGGTTTGAGTCGGGACAGGAGCTTCAGAGCCTGGCAGGATTGTCAGCTGTC
TTCTGACATCATCTGTGGGGCAAGGGTCACAAGGAGTGACTTGTGTTCCTGTGCTCTGGGACAC
AGAGCTAGTCATCATTCAGCCAATGTTAGCATAGTTCCTAGAAGTAGACTCTTGACACGCATTC
ACTAGTTTATGCTAATTTGTTCTTGTTTTAATAATAATTTGTTCAAGTTTTTTTTTGTTTGTTT
TGTTTCTTAGACTAAATACAGAGTTGGAATAAATTAGATAAAGCAATCTAGTGGTTAAAATCCC
ATTTGTATTTTATTTTCTGGAATATGTTTTTCATGGTTACTTGTTTTAAAAGATTTTAAAAAAT
CATTGCACTTTGGTCAGAAAGATAATAAATATATCTTATAAATGTTTGATTCCCTTCCTGCTTG
CTTTTTCAATAAAGTTTGAAAGTCCAAGTGATTTTCTTTCTCTAAAAAATTAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287399 ⟹ XP_063143469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	133,717,073 - 133,744,623 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020826	(Get FASTA)	NCBI Sequence Viewer
	XP_063143469	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98727	(Get FASTA)	NCBI Sequence Viewer
	EDL90325	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068780
GenBank Protein	Q4KM73	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020826 ⟸ NM_001025655

- UniProtKB:

Q4KM73 (UniProtKB/Swiss-Prot), A0A8I6AP91 (UniProtKB/TrEMBL), A6JZ28 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSSCRRWLLHVLVPSFPPLTRGLRFFPLQLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLS
AGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRN
QDNLQGWNKTMDGKADVSFVLFFDCNNEICIDRCLERGKSSGRSDDNRESLEKRIQTYLESTKP
IIDLYEEMGKVKKIDASKSVDEVFGDVMKIFDKEG

hide sequence

Ensembl Acc Id:

ENSRNOP00000010318 ⟸ ENSRNOT00000010318

Ensembl Acc Id:

ENSRNOP00000068780 ⟸ ENSRNOT00000081051

Ensembl Acc Id:

ENSRNOP00000095458 ⟸ ENSRNOT00000104723

RefSeq Acc Id:	XP_063143469 ⟸ XM_063287399
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JTN5 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KM73-F1-model_v2	AlphaFold	Q4KM73	1-196	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693920

Promoter ID:

EPDNEW_R4439

Type:

initiation region

Name:

Cmpk1_1

Description:

cytidine/uridine monophosphate kinase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	133,786,372 - 133,786,432	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310116	AgrOrtholog
BioCyc Gene	G2FUF-40307	BioCyc
BioCyc Pathway	PWY-7176 [UTP and CTP de novo biosynthesis]	BioCyc
	PWY-7197 [pyrimidine deoxyribonucleotide phosphorylation]	BioCyc
	PWY-7205 [CMP phosphorylation]	BioCyc
BioCyc Pathway Image	PWY-7176	BioCyc
	PWY-7197	BioCyc
	PWY-7205	BioCyc
Ensembl Genes	ENSRNOG00000007775	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000081051	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7379366	IMAGE-MGC_LOAD
InterPro	Adenylat/UMP-CMP_kin	UniProtKB/Swiss-Prot
	Adenylat_kinase_CS	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	UMP_CMP_kinase	UniProtKB/Swiss-Prot
KEGG Report	rno:298410	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112719	IMAGE-MGC_LOAD
NCBI Gene	298410	ENTREZGENE
PANTHER	PTHR23359	UniProtKB/Swiss-Prot
Pfam	ADK	UniProtKB/Swiss-Prot
PharmGKB	CMPK1	RGD
PhenoGen	Cmpk1	PhenoGen
PRINTS	ADENYLTKNASE	UniProtKB/Swiss-Prot
PROSITE	ADENYLATE_KINASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007775	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A0G2JSJ2_RAT	UniProtKB/TrEMBL
	A0A0G2JTN5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AP91	ENTREZGENE, UniProtKB/TrEMBL
	A6JZ28	ENTREZGENE, UniProtKB/TrEMBL
	KCY_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-25	Cmpk1	cytidine/uridine monophosphate kinase 1	Cmpk1	cytidine monophosphate (UMP-CMP) kinase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-05	Cmpk1	cytidine monophosphate (UMP-CMP) kinase 1	Cmpk1	cytidine monophosphate (UMP-CMP) kinase 1, cytosolic	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Cmpk1	cytidine monophosphate (UMP-CMP) kinase 1, cytosolic	Cmpk	cytidylate kinase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Cmpk	cytidylate kinase	RGD1310116	similar to UMP-CMP kinase	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310116	similar to UMP-CMP kinase	RGD1310116_predicted	similar to UMP-CMP kinase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310116_predicted	similar to UMP-CMP kinase (predicted)	LOC298410_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298410_predicted	similar to UMP-CMP kinase (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways