Dbndd1 (dysbindin domain containing 1)

Gene: Dbndd1 (dysbindin domain containing 1) Rattus norvegicus

Analyze

Symbol:

Dbndd1

Name:

dysbindin domain containing 1

RGD ID:

1310008

Description:

Predicted to be located in cytoplasm. Orthologous to human DBNDD1 (dysbindin domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dysbindin (dystrobrevin binding protein 1) domain containing 1; dysbindin domain-containing protein 1; LOC361437; RGD1310008; similar to RIKEN cDNA 2810427I04, DNA segment, Chr 8, ERATO Doi 590, expressed

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DBNDD1 (dysbindin domain containing 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):	Dbndd1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dbndd1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DBNDD1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DBNDD1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dbndd1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DBNDD1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DBNDD1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dbndd1 (dysbindin domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TM9SF2 (transmembrane 9 superfamily member 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Dbndd1 (dysbindin domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DBNDD1 (dysbindin domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-174d20.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dbndd1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	68,447,641 - 68,461,272 (-)	NCBI		GRCr8
mRatBN7.2	19	51,539,154 - 51,548,441 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	51,539,148 - 51,548,444 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	58,337,394 - 58,346,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	59,011,311 - 59,020,607 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	61,236,005 - 61,245,314 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	56,302,704 - 56,311,991 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	56,302,705 - 56,311,991 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	67,012,417 - 67,021,168 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	53,825,048 - 53,834,055 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	53,829,929 - 53,838,936 (-)	NCBI
Celera	19	50,770,518 - 50,779,793 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive chronic granulomatous disease 4 (ISO)

Fanconi anemia (ISO)

genetic disease (ISO)

primary ciliary dyskinesia 33 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

ketamine (EXP)

Monobutylphthalate (EXP)

monosodium L-glutamate (ISO)

O-methyleugenol (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:19573021	PMID:20531346	PMID:21502952	PMID:21998198	PMID:22337344	PMID:23954924	PMID:24385487

Genomics

Comparative Map Data

Dbndd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	68,447,641 - 68,461,272 (-)	NCBI		GRCr8
mRatBN7.2	19	51,539,154 - 51,548,441 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	51,539,148 - 51,548,444 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	58,337,394 - 58,346,710 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	59,011,311 - 59,020,607 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	61,236,005 - 61,245,314 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	56,302,704 - 56,311,991 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	56,302,705 - 56,311,991 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	67,012,417 - 67,021,168 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	53,825,048 - 53,834,055 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	53,829,929 - 53,838,936 (-)	NCBI
Celera	19	50,770,518 - 50,779,793 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

DBNDD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	90,004,871 - 90,019,890 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	90,004,871 - 90,019,890 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	90,071,279 - 90,086,298 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	88,598,780 - 88,613,438 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	75,136,096 - 75,150,124 (-)	NCBI		Celera
Cytogenetic Map	16	q24.3	NCBI
HuRef	16	75,763,537 - 75,777,892 (-)	NCBI		HuRef
CHM1_1	16	91,483,065 - 91,497,720 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	96,090,776 - 96,106,065 (-)	NCBI		T2T-CHM13v2.0

Dbndd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	124,231,744 - 124,245,535 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	124,231,457 - 124,242,202 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	123,504,718 - 123,518,277 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	123,504,718 - 123,515,463 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	126,028,618 - 126,039,355 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	126,391,778 - 126,401,442 (-)	NCBI		MGSCv36	mm8
Celera	8	127,744,865 - 127,755,598 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	72.1	NCBI

Dbndd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955541	3,463,773 - 3,470,293 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955541	3,462,667 - 3,465,769 (-)	NCBI	ChiLan1.0	ChiLan1.0

DBNDD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	99,851,990 - 99,866,367 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	105,739,689 - 105,754,041 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	70,762,881 - 70,777,339 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	90,426,028 - 90,430,480 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	90,426,028 - 90,441,525 (-)	Ensembl	panpan1.1		panPan2

DBNDD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	63,608,941 - 63,621,927 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	63,619,160 - 63,620,670 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	63,626,664 - 63,638,278 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	63,841,594 - 63,853,221 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	63,841,630 - 63,850,101 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	63,861,944 - 63,873,556 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	63,699,658 - 63,711,276 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	64,105,815 - 64,117,437 (+)	NCBI		UU_Cfam_GSD_1.0

Dbndd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	24,368,062 - 24,371,629 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	120,849 - 124,124 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	121,313 - 125,189 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DBNDD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	111,212 - 119,102 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	111,053 - 119,112 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	215,306 - 223,327 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DBNDD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	75,327,897 - 75,341,271 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	74,103 - 88,268 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dbndd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	49,455 - 57,585 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	49,537 - 58,709 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dbndd1
72 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	148
Count of miRNA genes:	107
Interacting mature miRNAs:	116
Transcripts:	ENSRNOT00000014090
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	19	33838214	55283146	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	44340214	55283277	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	49976481	53225766	Rat

Markers in Region

RH132136

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,539,194 - 51,539,379 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,302,745 - 56,302,929	NCBI	Rnor6.0
Rnor_5.0	19	67,012,458 - 67,012,642	UniSTS	Rnor5.0
RGSC_v3.4	19	53,825,089 - 53,825,273	UniSTS	RGSC3.4
Celera	19	50,770,559 - 50,770,743	UniSTS
RH 3.4 Map	19	753.99	UniSTS
Cytogenetic Map	19	q12	UniSTS

RH133199

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,538,921 - 51,539,129 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,302,472 - 56,302,679	NCBI	Rnor6.0
Rnor_5.0	19	67,012,185 - 67,012,392	UniSTS	Rnor5.0
RGSC_v3.4	19	53,824,816 - 53,825,023	UniSTS	RGSC3.4
Celera	19	50,770,286 - 50,770,493	UniSTS
RH 3.4 Map	19	712.01	UniSTS
Cytogenetic Map	19	q12	UniSTS

BF399501

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	51,539,920 - 51,540,147 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	56,303,471 - 56,303,697	NCBI	Rnor6.0
Rnor_5.0	19	67,013,184 - 67,013,410	UniSTS	Rnor5.0
RGSC_v3.4	19	53,825,815 - 53,826,041	UniSTS	RGSC3.4
Celera	19	50,771,285 - 50,771,511	UniSTS
RH 3.4 Map	19	708.81	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									68		1
Low	3	1	18	2	17	2	7	7	6	28	38	10	7
Below cutoff		30	23	23	2	23	1	4		7	2	1	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC140683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014090 ⟹ ENSRNOP00000014090

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	51,539,151 - 51,548,444 (-)	Ensembl
Rnor_6.0 Ensembl	19	56,302,705 - 56,311,991 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105889 ⟹ ENSRNOP00000096975

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	51,539,148 - 51,548,441 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109686 ⟹ ENSRNOP00000086403

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	51,540,154 - 51,548,441 (-)	Ensembl

RefSeq Acc Id:

NM_001014156 ⟹ NP_001014178

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	68,447,641 - 68,456,928 (-)	NCBI
mRatBN7.2	19	51,539,154 - 51,548,441 (-)	NCBI
Rnor_6.0	19	56,302,704 - 56,311,991 (-)	NCBI
Rnor_5.0	19	67,012,417 - 67,021,168 (-)	NCBI
RGSC_v3.4	19	53,825,048 - 53,834,055 (-)	RGD
Celera	19	50,770,518 - 50,779,793 (-)	RGD

Sequence:

show sequence

GGCTGCTGGAGATGGGGAGGGGAGCGGCGCCAGAAGCAGCTGCGCGCCCCGCCCCGCGGGCTCC
TCCCCGCCGCCGCGGCCCCTTTGCTGCTGCCCCGATGCGCTGTGCCCGAAGCCTGGACCCAGTA
GTCATCAGAGCAATTGGGGCACCCAGGCTGTCGCCGCCGCTGCCCACACCCCTCGCGGACCCCA
TTGGCCGCATGGAGTCTCCCGAGGGCGCAGGTCCGGGAGAGATCACTAAAGAAGTCAAGGTACC
ACAGGCTGCCCCGAGTGTTCCAGCTCATGAGACGGGGGACACTTGCCATACGCCTGTGGCGGCG
GTGGAGGAGGAAGTTGGCATCCCAATACCAGCACCAGGGTTCCTGCAGGTCACGGAGAGGAGGC
AGCCTCTGAGCAGTGTCTCCTCTCTGGAGGTTCACTTTGATCTCCTGGACCTCACTGAGCTGAC
CGACATGTCTGACCAGGAGCTGGCCGAGGTCTTTGCGGACTCTGACGACGAAAATCTTGCCACT
GAGTCCCCGGCAGGTCTGCACCCACTGTCTCGGGCCAGCTGCCTACGCTCGCCGTCCTGGACGA
AGACAAGGGCGGAGCAGAACCGTGAGAAACAGACCCCCAGTGACCCAGAGCGGCAAGGGACAAT
TGTGGACACATTCCTCACTGTGGAGGAGCCCAAGGAAGATTAGCCCATCTCCTGTTCTGGAGTT
GCTGAAGGGCTGGGCCAGACCACCATAATGGCACCATGGGACAGTACTGGCACGAGAGGCACTC
TGCCAACTCTAAGACTCCAGCCATCAATCACCCCCTGACAACGTGGCAAAGTCCAGGTGCCAGG
CTTAGGCCTCTGGGCGCCCTGGCACAAGCACAGCCCAGTGGCCTTAGGTCCAGCTGGCTCCTGG
ACCCTAAATGAGGGATGACATCGAATGGAGTCTCTGCCTTGGGATTAGAGAAGGGACATTCAGT
GGTGACCTAGAGTCTTATCAAAACGTGTCTCTGGGACAAGACCTTTTGTCTCTTGTGAGATTCC
AAGTAGATTCAAAGTAAGGGTTCCAAGCCCACGAGAGCTGCCCAGGAACCTGTAGGCGTTTTAT
CTCCAATGCCAATGAGCTCAAAAGCTCAGAGTAGATTTGGTGGTAGGTCAGGGGCTGGCTCTGC
TGTCCAGCCAAGTGGCATTGGTGGGTGTTGCTTCCCTAAGATCTCCACCTTGACCTTTAAACCC
TTCTTCTGCCCTAGGCAGGCAAGTCTGTTTCCAGTCTCCGCCCCAGGCCCTCGCTGTTCTGTGG
GTGACATGTGAAAGGCTGAGAAACTGCCCCATGTCTTCCTTAGTTCAGAACATCCAACCTCAGT
GGTGACTCCCAGATGGCTCGGAAGGACAGAGTGCCATCTCCACAGTCCTGTGTCTGTCAGAGAG
GCACACTGTCTGTCCTTCACATCCCACTGCCTGGCCTGACCACCCACATAGCCTGTCAGATGTT
CAGTTGGGAGGCCCCGACACTGTGGAGCTGTCTCAGGAGCAGCTCAGGTAGCAGGGACGACCTA
GCCCCCCCGCTGTGCTCTGAGACGCTGGGCACTCAGTTTAGACTCTCAACATGCCTTTCATGTG
CACGAGGACAAAGCACACTGGCTGCTCTGATCACGAATCAAAGACTGGTTTTGAAATAAAGGTT
TACTTGCTTTTTGTCCCTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063278165 ⟹ XP_063134235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	68,447,641 - 68,461,272 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014178	(Get FASTA)	NCBI Sequence Viewer
	XP_063134235	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88277	(Get FASTA)	NCBI Sequence Viewer
	EDL92815	(Get FASTA)	NCBI Sequence Viewer
	EDL92816	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014090.7
	ENSRNOP00000086403.1
	ENSRNOP00000096975.1
GenBank Protein	Q5M831	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014178 ⟸ NM_001014156

- UniProtKB:

Q5M831 (UniProtKB/Swiss-Prot), A0A0A0MXW5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGRGAAPEAAARPAPRAPPRRRGPFAAAPMRCARSLDPVVIRAIGAPRLSPPLPTPLADPIGRM
ESPEGAGPGEITKEVKVPQAAPSVPAHETGDTCHTPVAAVEEEVGIPIPAPGFLQVTERRQPLS
SVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLATESPAGLHPLSRASCLRSPSWTKTRA
EQNREKQTPSDPERQGTIVDTFLTVEEPKED

hide sequence

RefSeq Acc Id:

ENSRNOP00000014090 ⟸ ENSRNOT00000014090

RefSeq Acc Id:

ENSRNOP00000096975 ⟸ ENSRNOT00000105889

RefSeq Acc Id:

ENSRNOP00000086403 ⟸ ENSRNOT00000109686

RefSeq Acc Id:	XP_063134235 ⟸ XM_063278165
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M831-F1-model_v2	AlphaFold	Q5M831	1-160	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310008	AgrOrtholog
BioCyc Gene	G2FUF-5321	BioCyc
Ensembl Genes	ENSRNOG00000026974	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014090.6	UniProtKB/TrEMBL
	ENSRNOT00000105889.1	UniProtKB/TrEMBL
	ENSRNOT00000109686.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7381798	IMAGE-MGC_LOAD
InterPro	Dysbindin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:361437	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109128	IMAGE-MGC_LOAD
NCBI Gene	361437	ENTREZGENE
PANTHER	DYSBINDIN DOMAIN-CONTAINING PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR16294	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Dysbindin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dbndd1	PhenoGen
RatGTEx	ENSRNOG00000026974	RatGTEx
UniProt	A0A0A0MXW5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AUA7_RAT	UniProtKB/TrEMBL
	A0A8I6GEW7_RAT	UniProtKB/TrEMBL
	DBND1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-22	Dbndd1	dysbindin domain containing 1	Dbndd1	dysbindin (dystrobrevin binding protein 1) domain containing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-26	Dbndd1	dysbindin (dystrobrevin binding protein 1) domain containing 1	RGD1310008	similar to RIKEN cDNA 2810427I04; DNA segment, Chr 8, ERATO Doi 590, expressed	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1310008	similar to RIKEN cDNA 2810427I04; DNA segment, Chr 8, ERATO Doi 590, expressed	RGD1310008_predicted	similar to RIKEN cDNA 2810427I04; DNA segment, Chr 8, ERATO Doi 590, expressed (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310008_predicted	similar to RIKEN cDNA 2810427I04; DNA segment, Chr 8, ERATO Doi 590, expressed (predicted)	LOC361437_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361437_predicted	similar to RIKEN cDNA 2810427I04; DNA segment, Chr 8, ERATO Doi 590, expressed (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar