Advanced Search (OLGA)

Gene: Fli1 (Fli-1 proto-oncogene, ETS transcription factor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fli1

Name:

Fli-1 proto-oncogene, ETS transcription factor

RGD ID:

1309837

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in cell differentiation and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including blood circulation; megakaryocyte development; and regulation of DNA-templated transcription. Predicted to be located in cytosol and nuclear body. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in blood platelet disease and thrombocytopenia. Orthologous to human FLI1 (Fli-1 proto-oncogene, ETS transcription factor); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Friend leukemia integration 1; Friend leukemia integration 1 transcription factor; Friend leukemia integration 1 transcription factor-like; Friend leukemia virus integration 1; LOC100910769; LOC315532

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI		GRCr8
mRatBN7.2	8	30,831,422 - 30,950,468 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	34,903,577 - 35,021,956 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	33,197,989 - 33,316,402 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	31,060,872 - 31,179,270 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	33,541,932 - 33,661,111 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	32,196,722 - 32,318,548 (-)	NCBI
Celera	8	32,284,160 - 32,401,673 (-)	NCBI		Celera
Cytogenetic Map	8	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	thrombocytopenia		ISO	FLI1 (Homo sapiens)	1582490		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	chromosome 11 partial duplication syndrome		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Distal trisomy 11q	ClinVar	PMID:25741868
Fli1	Rat	Dwarfism		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:32581362
Fli1	Rat	genetic disease		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
Fli1	Rat	hemorrhagic disease		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Abnormal bleeding	ClinVar	PMID:24100448 and PMID:32581362
Fli1	Rat	Jacobsen Syndrome		ISO	FLI1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:15798196 more ...
Fli1	Rat	platelet-type bleeding disorder 15		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bleeding disorder platelet type macrothrombocytopenia	ClinVar	PMID:23809206 and PMID:26316623
Fli1	Rat	Platelet-Type Bleeding Disorder 21		ISO	FLI1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:15798196 more ...
Fli1	Rat	schizophrenia		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
Fli1	Rat	thrombocytopenia		ISO	FLI1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Thrombocytopenia	ClinVar	PMID:24100448 and PMID:32581362

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	Ewing sarcoma		ISO	FLI1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11772151 more ...
Fli1	Rat	Experimental Liver Cirrhosis		ISO	FLI1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136
Fli1	Rat	medulloblastoma		ISO	FLI1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19270706

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	systemic scleroderma		ISS	Fli1 (Mus musculus)	13592920	OMIM:181750	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	Platelet-Type Bleeding Disorder 21		ISO	FLI1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Fli1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of FLI1 mRNA	CTD	PMID:22206623
Fli1	Rat	1,3-dinitrobenzene	increases expression	EXP		6480464	3-dinitrobenzene results in increased expression of FLI1 mRNA	CTD	PMID:21983209
Fli1	Rat	17beta-estradiol	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of FLI1 mRNA	CTD	PMID:30165855
Fli1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Fli1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of FLI1 mRNA	CTD	PMID:21570461 and PMID:24058054
Fli1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Fli1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of FLI1 mRNA	CTD	PMID:37172768
Fli1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of FLI1 mRNA	CTD	PMID:34747641
Fli1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FLI1 mRNA	CTD	PMID:32109520
Fli1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Fli1	Rat	2-palmitoylglycerol	increases expression	ISO	FLI1 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of FLI1 mRNA	CTD	PMID:37199045
Fli1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FLI1 mRNA	CTD	PMID:28628672
Fli1	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4 and 4'-diaminodiphenylmethane results in increased expression of FLI1 mRNA	CTD	PMID:25380136 and PMID:30723492
Fli1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Fli1 (Mus musculus)	6480464	bisphenol S results in increased expression of FLI1 mRNA	CTD	PMID:30951980
Fli1	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	bisphenol S results in increased methylation of FLI1 gene	CTD	PMID:31601247
Fli1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Fli1 (Mus musculus)	6480464	Fenretinide results in increased expression of FLI1 mRNA	CTD	PMID:28973697
Fli1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of FLI1 mRNA	CTD	PMID:24780913
Fli1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of FLI1 mRNA	CTD	PMID:31881176
Fli1	Rat	aflatoxin B1	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of FLI1 intron	CTD	PMID:30157460
Fli1	Rat	Aflatoxin B2 alpha	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of FLI1 intron	CTD	PMID:30157460
Fli1	Rat	all-trans-retinoic acid	increases expression	ISO	Fli1 (Mus musculus)	6480464	Tretinoin results in increased expression of FLI1 mRNA	CTD	PMID:16211290
Fli1	Rat	all-trans-retinoic acid	increases expression	ISO	FLI1 (Homo sapiens)	6480464	Tretinoin results in increased expression of FLI1 mRNA	CTD	PMID:21934132 and PMID:33167477
Fli1	Rat	anagrelide	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	anagrelide inhibits the reaction [THPO protein results in increased expression of FLI1 mRNA]	CTD	PMID:20586925
Fli1	Rat	arsane	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of FLI1 mRNA	CTD	PMID:39836092
Fli1	Rat	arsenic atom	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of FLI1 mRNA	CTD	PMID:39836092
Fli1	Rat	arsenite(3-)	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	arsenite results in increased methylation of FLI1 promoter	CTD	PMID:23974009
Fli1	Rat	atrazine	increases expression	ISO	FLI1 (Homo sapiens)	6480464	Atrazine results in increased expression of FLI1 mRNA	CTD	PMID:22378314
Fli1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of FLI1 gene	CTD	PMID:28931070 and PMID:35440735
Fli1	Rat	benzo[a]pyrene	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of FLI1 mRNA	CTD	PMID:20064835
Fli1	Rat	benzo[a]pyrene	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of FLI1 3' UTR and Benzo(a)pyrene results in increased methylation of FLI1 promoter	CTD	PMID:27901495
Fli1	Rat	benzo[a]pyrene	increases expression	ISO	Fli1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of FLI1 mRNA	CTD	PMID:32417428
Fli1	Rat	benzo[a]pyrene	affects methylation	ISO	FLI1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of FLI1 intron	CTD	PMID:30157460
Fli1	Rat	benzo[a]pyrene	increases methylation	ISO	Fli1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of FLI1 intron	CTD	PMID:27901495
Fli1	Rat	benzo[a]pyrene diol epoxide I	affects expression	ISO	FLI1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Fli1	Rat	benzo[e]pyrene	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of FLI1 intron	CTD	PMID:30157460
Fli1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	FLI1 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in increased expression of FLI1 mRNA	CTD	PMID:31163220
Fli1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FLI1 mRNA	CTD	PMID:25181051
Fli1	Rat	bisphenol A	decreases methylation	ISO	FLI1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of FLI1 gene	CTD	PMID:31601247
Fli1	Rat	bisphenol A	increases expression	ISO	Fli1 (Mus musculus)	6480464	bisphenol A results in increased expression of FLI1 mRNA	CTD	PMID:30951980 and PMID:32156529
Fli1	Rat	bisphenol A	affects methylation	ISO	Fli1 (Mus musculus)	6480464	bisphenol A affects the methylation of FLI1 promoter	CTD	PMID:27334623
Fli1	Rat	bisphenol A	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] affects the methylation of FLI1 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FLI1 mRNA	CTD	PMID:28628672 and PMID:31601247
Fli1	Rat	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of FLI1 mRNA	CTD	PMID:27567155
Fli1	Rat	bisphenol F	increases expression	ISO	Fli1 (Mus musculus)	6480464	bisphenol F results in increased expression of FLI1 mRNA	CTD	PMID:30951980
Fli1	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of FLI1 mRNA	CTD	PMID:33453195
Fli1	Rat	cadmium dichloride	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of FLI1 mRNA	CTD	PMID:38568856
Fli1	Rat	choline	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FLI1 more ...	CTD	PMID:20938992
Fli1	Rat	chromium(6+)	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	chromium hexavalent ion results in decreased expression of FLI1 mRNA	CTD	PMID:30690063
Fli1	Rat	copper(II) chloride	increases expression	ISO	FLI1 (Homo sapiens)	6480464	cupric chloride results in increased expression of FLI1 mRNA	CTD	PMID:38568856
Fli1	Rat	cyclosporin A	decreases methylation	ISO	FLI1 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of FLI1 promoter	CTD	PMID:27989131
Fli1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of FLI1 mRNA	CTD	PMID:23640034
Fli1	Rat	dexamethasone	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FLI1 mRNA	CTD	PMID:28628672
Fli1	Rat	dimethylarsinic acid	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FLI1 mRNA	CTD	PMID:34876320
Fli1	Rat	dorsomorphin	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Fli1	Rat	doxorubicin	affects response to substance	ISO	FLI1 (Homo sapiens)	6480464	FLI1 protein affects the susceptibility to Doxorubicin	CTD	PMID:16217747
Fli1	Rat	doxorubicin	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of FLI1 mRNA	CTD	PMID:29803840
Fli1	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of FLI1 mRNA	CTD	PMID:29391264
Fli1	Rat	finasteride	decreases expression	EXP		6480464	Finasteride results in decreased expression of FLI1 mRNA	CTD	PMID:24136188
Fli1	Rat	flutamide	decreases expression	EXP		6480464	Flutamide results in decreased expression of FLI1 mRNA	CTD	PMID:24136188
Fli1	Rat	folic acid	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FLI1 more ...	CTD	PMID:20938992
Fli1	Rat	folic acid	decreases expression	ISO	Fli1 (Mus musculus)	6480464	Folic Acid results in decreased expression of FLI1 mRNA	CTD	PMID:25629700
Fli1	Rat	fulvestrant	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] affects the methylation of FLI1 gene	CTD	PMID:31601247
Fli1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of FLI1 mRNA	CTD	PMID:22061828
Fli1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of FLI1 mRNA	CTD	PMID:33387578
Fli1	Rat	indometacin	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of FLI1 mRNA	CTD	PMID:28628672
Fli1	Rat	L-methionine	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of FLI1 more ...	CTD	PMID:20938992
Fli1	Rat	mercury dibromide	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FLI1 mRNA	CTD	PMID:27188386
Fli1	Rat	methapyrilene	increases methylation	ISO	FLI1 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of FLI1 intron	CTD	PMID:30157460
Fli1	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of FLI1 gene	CTD	PMID:35440735
Fli1	Rat	methyl methanesulfonate	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of FLI1 mRNA	CTD	PMID:23649840
Fli1	Rat	methylarsonic acid	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FLI1 mRNA	CTD	PMID:34876320
Fli1	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of FLI1 mRNA	CTD	PMID:25380136
Fli1	Rat	nickel sulfate	increases expression	ISO	FLI1 (Homo sapiens)	6480464	nickel sulfate results in increased expression of FLI1 mRNA	CTD	PMID:22714537
Fli1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of FLI1 mRNA	CTD	PMID:25729387
Fli1	Rat	oxybenzone	decreases expression	ISO	Fli1 (Mus musculus)	6480464	oxybenzone results in decreased expression of FLI1 mRNA	CTD	PMID:39343157
Fli1	Rat	ozone	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of FLI1 mRNA	CTD	PMID:34911549
Fli1	Rat	ozone	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of FLI1 mRNA	CTD	PMID:35430440
Fli1	Rat	paracetamol	affects expression	ISO	Fli1 (Mus musculus)	6480464	Acetaminophen affects the expression of FLI1 mRNA	CTD	PMID:17562736
Fli1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of FLI1 mRNA	CTD	PMID:33387578
Fli1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	Fli1 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of FLI1 mRNA	CTD	PMID:37995155
Fli1	Rat	phenobarbital	affects expression	ISO	Fli1 (Mus musculus)	6480464	Phenobarbital affects the expression of FLI1 mRNA	CTD	PMID:23091169
Fli1	Rat	phenylmercury acetate	increases expression	ISO	FLI1 (Homo sapiens)	6480464	Phenylmercuric Acetate results in increased expression of FLI1 mRNA	CTD	PMID:26272509
Fli1	Rat	phenylmercury acetate	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of FLI1 mRNA	CTD	PMID:27188386
Fli1	Rat	pirinixic acid	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of FLI1 mRNA	CTD	PMID:19710929
Fli1	Rat	potassium chromate	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of FLI1 mRNA	CTD	PMID:22714537
Fli1	Rat	romidepsin	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	romidepsin results in decreased expression of FLI1 mRNA mutant form	CTD	PMID:15849726
Fli1	Rat	romidepsin	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	romidepsin results in decreased activity of and results in decreased expression of FLI1 protein mutant form	CTD	PMID:15849726
Fli1	Rat	SB 431542	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Fli1	Rat	sodium arsenate	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FLI1 mRNA	CTD	PMID:34876320
Fli1	Rat	sodium arsenite	increases expression	ISO	FLI1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of FLI1 mRNA	CTD	PMID:12634122
Fli1	Rat	sodium arsenite	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of FLI1 mRNA	CTD	PMID:34876320
Fli1	Rat	sodium arsenite	multiple interactions	ISO	FLI1 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of FLI1 mRNA	CTD	PMID:39836092
Fli1	Rat	sodium arsenite	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of FLI1 mRNA	CTD	PMID:34032870
Fli1	Rat	sodium arsenite	affects methylation	ISO	FLI1 (Homo sapiens)	6480464	sodium arsenite affects the methylation of FLI1 gene	CTD	PMID:28589171
Fli1	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of FLI1 mRNA	CTD	PMID:19281266
Fli1	Rat	succimer	multiple interactions	ISO	Fli1 (Mus musculus)	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of FLI1 mRNA	CTD	PMID:21641980
Fli1	Rat	sulindac	decreases expression	EXP		6480464	Sulindac results in decreased expression of FLI1 mRNA	CTD	PMID:24136188
Fli1	Rat	tetrachloromethane	increases expression	ISO	Fli1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of FLI1 mRNA	CTD	PMID:27339419 and PMID:31919559
Fli1	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	FLI1 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of FLI1 mRNA	CTD	PMID:34925699
Fli1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of FLI1 mRNA	CTD	PMID:34492290
Fli1	Rat	titanium dioxide	decreases expression	ISO	Fli1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of FLI1 mRNA	CTD	PMID:23557971 and PMID:29264374
Fli1	Rat	titanium dioxide	decreases methylation	ISO	Fli1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FLI1 gene and titanium dioxide results in decreased methylation of FLI1 promoter	CTD	PMID:35295148
Fli1	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of FLI1 mRNA	CTD	PMID:25729387
Fli1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of FLI1 mRNA	CTD	PMID:25729387
Fli1	Rat	tributylstannane	increases expression	EXP		6480464	tributyltin results in increased expression of FLI1 mRNA	CTD	PMID:21683754
Fli1	Rat	trichostatin A	increases expression	ISO	FLI1 (Homo sapiens)	6480464	trichostatin A results in increased expression of FLI1 mRNA	CTD	PMID:24935251
Fli1	Rat	valproic acid	affects expression	ISO	Fli1 (Mus musculus)	6480464	Valproic Acid affects the expression of FLI1 mRNA	CTD	PMID:17292431
Fli1	Rat	valproic acid	decreases expression	ISO	FLI1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of FLI1 mRNA	CTD	PMID:23179753 and PMID:27188386
Fli1	Rat	valproic acid	increases expression	ISO	FLI1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of FLI1 mRNA	CTD	PMID:24935251 and PMID:28001369
Fli1	Rat	vincaleukoblastine	affects response to substance	ISO	FLI1 (Homo sapiens)	6480464	FLI1 protein affects the susceptibility to Vinblastine	CTD	PMID:16217747

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	animal organ morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	animal organ morphogenesis	acts_upstream_of_or_within	ISO	Fli1 (Mus musculus)	1624291	MGI:1888942 PMID:10981960	RGD	PMID:10981960
Fli1	Rat	blood circulation	acts_upstream_of_or_within	ISO	Fli1 (Mus musculus)	1624291	MGI:1888942 PMID:10981960	RGD	PMID:10981960
Fli1	Rat	blood circulation	acts_upstream_of_or_within	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	cell differentiation	involved_in	IBA	FB:FBgn0000097 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fli1	Rat	megakaryocyte development	acts_upstream_of_or_within	ISO	Fli1 (Mus musculus)	1624291	MGI:2386167 PMID:16757682	RGD	PMID:16757682
Fli1	Rat	megakaryocyte development	acts_upstream_of_or_within	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	FLI1 (Homo sapiens)	1624291	PMID:26316623 and PMID:31146003	RGD	PMID:26316623 and PMID:31146003
Fli1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	Fli1 (Mus musculus)	1624291	PMID:17606295	RGD	PMID:17606295
Fli1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR000418	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fli1	Rat	regulation of DNA-templated transcription	acts_upstream_of_or_within	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	Fli1 (Mus musculus)	1624291	MGI:1888942 PMID:10981960	RGD	PMID:10981960
Fli1	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0000097 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fli1	Rat	regulation of transcription by RNA polymerase II	involved_in	IEA	InterPro:IPR046328	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	cytosol	located_in	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	cytosol	located_in	ISO	FLI1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fli1	Rat	nuclear body	located_in	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	nuclear body	located_in	ISO	FLI1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fli1	Rat	nucleoplasm	located_in	ISO	FLI1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fli1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fli1	Rat	nucleus	located_in	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	nucleus	located_in	ISO	Fli1 (Mus musculus)	1624291	PMID:12527908	RGD	PMID:12527908
Fli1	Rat	nucleus	is_active_in	IBA	FB:FBgn0000097 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fli1	Rat	nucleus	located_in	ISO	FLI1 (Homo sapiens)	1624291	PMID:28255014	RGD	PMID:28255014
Fli1	Rat	nucleus	located_in	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fli1	Rat	chromatin binding	enables	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	chromatin binding	enables	ISO	Fli1 (Mus musculus)	1624291	PMID:16757682	RGD	PMID:16757682
Fli1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fli1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	Fli1 (Mus musculus)	1624291	PMID:17606295	RGD	PMID:17606295
Fli1	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR000418 and InterPro:IPR046328	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fli1	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	FB:FBgn0000097 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fli1	Rat	protein binding	enables	ISO	FLI1 (Homo sapiens)	1624291	UniProtKB:O94993 more ...	RGD	PMID:20211142 and PMID:25416956
Fli1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	Fli1 (Mus musculus)	1624291	PMID:17606295 and PMID:17962413	RGD	PMID:17606295 and PMID:17962413
Fli1	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	sequence-specific DNA binding	enables	IEA	UniProtKB:P26323 and ensembl:ENSMUSP00000016231	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	sequence-specific DNA binding	enables	ISO	Fli1 (Mus musculus)	1624291	PMID:21867929	RGD	PMID:21867929
Fli1	Rat	sequence-specific DNA binding	enables	IEA	InterPro:IPR000418 and InterPro:IPR003118	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fli1	Rat	sequence-specific double-stranded DNA binding	enables	ISO	FLI1 (Homo sapiens)	1624291	PMID:28473536	RGD	PMID:28473536
Fli1	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fli1	Rat	transcription cis-regulatory region binding	enables	ISO	FLI1 (Homo sapiens)	1624291	PMID:31146003	RGD	PMID:31146003
Fli1	Rat	transcription cis-regulatory region binding	enables	IEA	UniProtKB:Q01543 and ensembl:ENSP00000433488	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	FLI1 monoallelic expression combined with its hemizygous loss underlies Paris-Trousseau/Jacobsen thrombopenia.	Raslova H, etal., J Clin Invest. 2004 Jul;114(1):77-84.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10981960	PMID:12527908	PMID:16757682	PMID:17606295	PMID:17962413	PMID:21867929	PMID:26316623	PMID:28255014

Fli1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI		GRCr8
mRatBN7.2	8	30,831,422 - 30,950,468 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	34,903,577 - 35,021,956 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	33,197,989 - 33,316,402 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	31,060,872 - 31,179,270 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	33,541,932 - 33,661,111 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	32,196,722 - 32,318,548 (-)	NCBI
Celera	8	32,284,160 - 32,401,673 (-)	NCBI		Celera
Cytogenetic Map	8	q21	NCBI

FLI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	128,685,351 - 128,813,267 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	128,686,535 - 128,813,267 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	128,556,430 - 128,683,162 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	128,069,199 - 128,187,521 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	128,069,198 - 128,187,520	NCBI
Celera	11	125,728,561 - 125,849,286 (+)	NCBI		Celera
Cytogenetic Map	11	q24.3	NCBI
HuRef	11	124,504,750 - 124,631,960 (+)	NCBI		HuRef
CHM1_1	11	128,442,436 - 128,569,169 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	128,719,763 - 128,845,984 (+)	NCBI		T2T-CHM13v2.0

Fli1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	32,333,500 - 32,454,292 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	32,333,500 - 32,454,157 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	32,422,204 - 32,543,432 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	32,422,204 - 32,542,861 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	32,229,793 - 32,348,953 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	32,171,773 - 32,290,933 (-)	NCBI		MGSCv36	mm8
Celera	9	29,685,381 - 29,804,572 (-)	NCBI		Celera
Cytogenetic Map	9	A4	NCBI
cM Map	9	17.74	NCBI

Fli1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	29,654,459 - 29,775,903 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	29,653,621 - 29,773,412 (+)	NCBI	ChiLan1.0	ChiLan1.0

FLI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	129,376,354 - 129,494,803 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	130,484,068 - 130,602,419 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	123,506,859 - 123,626,024 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	127,409,301 - 127,527,521 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	127,409,301 - 127,530,312 (+)	Ensembl	panpan1.1		panPan2

FLI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	5,841,533 - 5,968,329 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	5,843,023 - 5,966,822 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	5,899,065 - 6,025,150 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	5,799,196 - 5,922,120 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	5,799,200 - 5,920,609 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	5,858,425 - 5,981,002 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	5,836,777 - 5,962,717 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	5,870,453 - 5,993,208 (-)	NCBI		UU_Cfam_GSD_1.0

Fli1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	110,872,609 - 111,001,492 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936572	3,448,862 - 3,577,836 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936572	3,448,870 - 3,576,406 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FLI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	55,612,901 - 55,749,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	55,612,905 - 55,749,784 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	61,707,515 - 61,810,415 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FLI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	119,817,987 - 119,945,378 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	119,827,222 - 119,946,662 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	6,144,187 - 6,261,677 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fli1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624812	3,004,628 - 3,139,101 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624812	3,004,631 - 3,138,901 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fli1
587 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	176
Count of miRNA genes:	135
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000068037
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	42692818	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	28157323	30848259	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	30848154	40713225	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat

D8Mit5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	39,106,258 - 39,106,363 (+)	Marker Load Pipeline
mRatBN7.2	8	30,848,154 - 30,848,259 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,558,660 - 33,558,764	NCBI	Rnor6.0
Rnor_5.0	8	33,603,024 - 33,603,128	UniSTS	Rnor5.0
RGSC_v3.4	8	32,203,394 - 32,203,499	RGD	RGSC3.4
RGSC_v3.4	8	32,203,395 - 32,203,499	UniSTS	RGSC3.4
RGSC_v3.1	8	32,212,161 - 32,212,265	RGD
Celera	8	32,299,483 - 32,299,583	UniSTS
RH 3.4 Map	8	248.5	RGD
RH 3.4 Map	8	248.5	UniSTS
RH 2.0 Map	8	167.4	RGD
Cytogenetic Map	8	q21	UniSTS

X59421

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,832,828 - 30,832,928 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,543,334 - 33,543,433	NCBI	Rnor6.0
Rnor_5.0	8	33,587,564 - 33,587,663	UniSTS	Rnor5.0
RGSC_v3.4	8	32,188,069 - 32,188,168	UniSTS	RGSC3.4
Celera	8	32,284,277 - 32,284,376	UniSTS
Cytogenetic Map	8	q21	UniSTS

RH138660

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,892,174 - 30,892,407 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,602,734 - 33,602,966	NCBI	Rnor6.0
Rnor_5.0	8	33,644,880 - 33,645,112	UniSTS	Rnor5.0
RGSC_v3.4	8	32,250,922 - 32,251,154	UniSTS	RGSC3.4
Celera	8	32,343,459 - 32,343,691	UniSTS
RH 3.4 Map	8	253.2	UniSTS
Cytogenetic Map	8	q21	UniSTS

Fli1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,832,911 - 30,833,057 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,543,417 - 33,543,562	NCBI	Rnor6.0
Rnor_5.0	8	33,587,647 - 33,587,792	UniSTS	Rnor5.0
RGSC_v3.4	8	32,188,152 - 32,188,297	UniSTS	RGSC3.4
Celera	8	32,284,360 - 32,284,505	UniSTS
Cytogenetic Map	8	q21	UniSTS

BF386415

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,930,560 - 30,930,712 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,641,183 - 33,641,334	NCBI	Rnor6.0
Rnor_5.0	8	33,683,329 - 33,683,480	UniSTS	Rnor5.0
RGSC_v3.4	8	32,289,916 - 32,290,067	UniSTS	RGSC3.4
Celera	8	32,381,833 - 32,381,984	UniSTS
RH 3.4 Map	8	254.2	UniSTS
Cytogenetic Map	8	q21	UniSTS

BF405592

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,930,799 - 30,931,015 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,641,422 - 33,641,637	NCBI	Rnor6.0
Rnor_5.0	8	33,683,568 - 33,683,783	UniSTS	Rnor5.0
RGSC_v3.4	8	32,290,155 - 32,290,370	UniSTS	RGSC3.4
Celera	8	32,382,072 - 32,382,287	UniSTS
RH 3.4 Map	8	253.5	UniSTS
Cytogenetic Map	8	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001017381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY972521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068037 ⟹ ENSRNOP00000059605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098203 ⟹ ENSRNOP00000085961

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118943 ⟹ ENSRNOP00000097598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	30,832,950 - 30,887,253 (-)	Ensembl

RefSeq Acc Id:

NM_001017381 ⟹ NP_001017381

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,533 - 39,208,557 (-)	NCBI
mRatBN7.2	8	30,831,429 - 30,950,468 (-)	NCBI
Rnor_6.0	8	33,543,217 - 33,661,049 (-)	NCBI
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	RGD
Celera	8	32,284,160 - 32,401,673 (-)	RGD

Sequence:

show sequence

CGGCACGAGGAGGACTTCCTCCCCGATCGCAAAGTGAAGTCACTTCCCAAAATTAGCTGAAAAAAAGTTTCATCCGGTTAACTGTCTCTTTTTCGATCCGCTACAACAACAAACGTGCACAGGGGAGC
GAGGGCAGGGTGCTCACAGGGGGCACTCAGAGAGGGCCCAGGGCGCCAAAGAGGCCGCGCCGGGCTAATCTGAAGGGGCTACGGGGTCAGGCTGTAACCGGGTCAATGTGTGGAATATTGGGGGGCTC
GGCTGCAGAATTGGCCAAATGGACGGGACTATTAAGGAGGCTCTGTCAGTGGTGAGTGACGACCAGTCCCTTTTTGATTCAGCATACGGAGCGGCCGCCCATCTCCCCAAGGCAGATATGACTGCTTC
GGGGAGTCCTGACTACGGGCAGCCCCACAAAATCAACCCCCTGCCACCACAGCAGGAGTGGATCAACCAGCCAGTGAGGGTCAATGTCAAGCGGGAATATGATCACATGAATGGATCCAGGGAGTCTC
CGGTGGACTGCAGTGTCAGCAAATGCAACAAGCTGGTGGGTGGAGGCGAAGCCAACCCCATGAACTACAATAGCTACATGGATGAGAAGAATGGCCCCCCTCCTCCCAACATGACCACCAACGAGCGG
AGAGTCATTGTGCCTGCAGACCCCACACTGTGGACACAGGAGCACGTTCGACAGTGGCTGGAGTGGGCCATAAAGGAATATGGCTTGATGGAGATTGACACTTCCTTCTTCCAGAACATGGATGGCAA
GGAACTGTGTAAAATGAGCAAGGAGGACTTCCTCCGAGCCACCTCCCTCTACAACACAGAAGTGCTGTTGTCGCACCTCAGTTACCTCAGGGAAAGTTCACTGCTGGCCTATAATACACCCTCCCACA
CAGACCAGTCCTCACGACTGAATGTCAAGGAAGACCCTTCTTATGACTCTGTCAGGAGAGGGGGATGGAGCAACAATATGAACTCTGGCATCAACAAAAGTCCTCCCCTTGGAGGAGCACAGAGCATG
GGCAAGAACACTGAGCAACGGCCCCAGCCAGATCCTTATCAGATCCTGGGGCCCACCAGCAGCCGCCTAGCAAACCCTGGAAGTGGGCAGATCCAACTGTGGCAGTTTCTCCTGGAACTACTGTCTGA
CAGCGCCAACGCCAGTTGCATTACTTGGGAGGGGACCAACGGGGAATTCAAAATGACGGACCCTGATGAGGTGGCCAGGCGCTGGGGAGAGCGGAAGAGCAAGCCCAACATGAATTACGATAAGCTGA
GCCGGGCCCTCCGATACTACTACGATAAAAACATTATGACCAAAGTGCATGGCAAAAGGTATGCCTACAAGTTTGACTTCCATGGCATTGCCCAAGCCCTGCAGCCACACCCAACAGAGACATCAATG
TACAAGTATCCTTCTGACATCTCCTACATGCCTTCCTACCATGCCCATCAACAAAAGGTGAACTTTGTCCAGCCCCACCCATCCTCCATGCCTGTCACCTCCTCCAGCTTCTTTGGAGCAGCGTCACA
ATACTGGACCTCCCCCACTGCGGGGATCTACCCGAACCCCAGTGTACCCCGCCATCCTAACACCCACGTGCCTTCACACTTAGGCAGCTACTACTAGAACTTAACACCAGTTGGCCTTCTGGCTGAAG
TTCCAGCCCTCACTTCTACTGGATACTCTGGACTCTAAAAGATGCTGTAGCTTTGAAGAGATAAGAAAACTGGATGTTCTTTCCTTTGGATAGAACCTTTGTACTTGTTCTTCTAAAAATGATTATTT
GTATGTTTAAAAAAAAAGAACTTTTGCTTCCTCTACCTAAAAAAGAAAAAAGAAAGAAAAAGAAAGAAAGAAAGAAAAA

hide sequence

RefSeq Acc Id:

XM_063265407 ⟹ XP_063121477

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,209,414 (-)	NCBI

RefSeq Acc Id:

XM_063265408 ⟹ XP_063121478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,186,629 (-)	NCBI

RefSeq Acc Id:

XM_063265409 ⟹ XP_063121479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI


Protein RefSeqs	NP_001017381	(Get FASTA)	NCBI Sequence Viewer
	XP_063121477	(Get FASTA)	NCBI Sequence Viewer
	XP_063121478	(Get FASTA)	NCBI Sequence Viewer
	XP_063121479	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX83256	(Get FASTA)	NCBI Sequence Viewer
	EDL83289	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059605
	ENSRNOP00000059605.1
	ENSRNOP00000085961
	ENSRNOP00000085961.1
	ENSRNOP00000097598
	ENSRNOP00000097598.1

RefSeq Acc Id:

NP_001017381 ⟸ NM_001017381

- UniProtKB:

Q4Z8P1 (UniProtKB/TrEMBL), F7FFL9 (UniProtKB/TrEMBL), A0A8I6ASZ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTNERRVIVPA
DPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMSKEDFLRATSLYNTEVLLSHLSYLRESSLLAYNTPSHTDQSSRLNVKEDPSYDSVRRGGWSNNMNSGINKSPPLGGAQSMGKNTEQ
RPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTETSMYKYPSD
ISYMPSYHAHQQKVNFVQPHPSSMPVTSSSFFGAASQYWTSPTAGIYPNPSVPRHPNTHVPSHLGSYY

hide sequence

Ensembl Acc Id:

ENSRNOP00000059605 ⟸ ENSRNOT00000068037

Ensembl Acc Id:

ENSRNOP00000097598 ⟸ ENSRNOT00000118943

Ensembl Acc Id:

ENSRNOP00000085961 ⟸ ENSRNOT00000098203

RefSeq Acc Id:	XP_063121479 ⟸ XM_063265409
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6ASZ2 (UniProtKB/TrEMBL)

Protein Domains

ETS PNT

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4Z8P1-F1-model_v2	AlphaFold	Q4Z8P1	1-452	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695832

Promoter ID:

EPDNEW_R6356

Type:

multiple initiation site

Name:

Fli1_1

Description:

Fli-1 proto-oncogene, ETS transcription factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	33,660,974 - 33,661,034	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-31234	BioCyc
Ensembl Genes	ENSRNOG00000008904	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000068037	ENTREZGENE
	ENSRNOT00000068037.2	UniProtKB/TrEMBL
	ENSRNOT00000098203	ENTREZGENE
	ENSRNOT00000098203.1	UniProtKB/TrEMBL
	ENSRNOT00000118943	ENTREZGENE
	ENSRNOT00000118943.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
	1.10.150.50	UniProtKB/TrEMBL
InterPro	Ets	UniProtKB/TrEMBL
	ETS_fam	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
	SAM_PNT-FLI-1	UniProtKB/TrEMBL
	SAM_type	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:315532	UniProtKB/TrEMBL
NCBI Gene	315532	ENTREZGENE
PANTHER	PTHR11849	UniProtKB/TrEMBL
	PTHR11849:SF161	UniProtKB/TrEMBL
Pfam	Ets	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
PhenoGen	Fli1	PhenoGen
PRINTS	ETSDOMAIN	UniProtKB/TrEMBL
PROSITE	ETS_DOMAIN_1	UniProtKB/TrEMBL
	ETS_DOMAIN_2	UniProtKB/TrEMBL
	ETS_DOMAIN_3	UniProtKB/TrEMBL
	PNT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008904	RatGTEx
SMART	ETS	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
Superfamily-SCOP	SAM_homology	UniProtKB/TrEMBL
	SSF46785	UniProtKB/TrEMBL
UniProt	A0A8I6A3J9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ASZ2	ENTREZGENE, UniProtKB/TrEMBL
	F7FFL9	ENTREZGENE, UniProtKB/TrEMBL
	Q4Z8P1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Fli1	Fli-1 proto-oncogene, ETS transcription factor	LOC100910769	Friend leukemia integration 1 transcription factor-like	Data merged from RGD:6496556	737654	PROVISIONAL
2013-08-14	Fli1	Fli-1 proto-oncogene, ETS transcription factor	Fli1	Friend leukemia virus integration 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100910769	Friend leukemia integration 1 transcription factor-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-24	Fli1	Friend leukemia virus integration 1	Fli1	Friend leukemia integration 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Fli1	Friend leukemia integration 1	Fli1_predicted	Friend leukemia integration 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Fli1_predicted	Friend leukemia integration 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM