Advanced Search (OLGA)

Gene: Fli1 (Fli-1 proto-oncogene, ETS transcription factor) Rattus norvegicus

Analyze

Symbol:

Fli1

Name:

Fli-1 proto-oncogene, ETS transcription factor

RGD ID:

1309837

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in cell differentiation and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including blood circulation; megakaryocyte development; and regulation of DNA-templated transcription. Predicted to be located in cytosol and nuclear body. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in blood platelet disease and thrombocytopenia. Orthologous to human FLI1 (Fli-1 proto-oncogene, ETS transcription factor); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Friend leukemia integration 1; Friend leukemia integration 1 transcription factor; Friend leukemia integration 1 transcription factor-like; Friend leukemia virus integration 1; LOC100910769; LOC315532

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fli1 (Friend leukemia integration 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fli1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fli1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fli1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fli1 (Fli-1 proto-oncogene, ETS transcription factor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FLI1 (Fli-1 proto-oncogene, ETS transcription factor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fli1 (Friend leukemia integration 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fli1a (Fli-1 proto-oncogene, ETS transcription factor a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ast-1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ast-1	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ets65A	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ets21C	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER)
Drosophila melanogaster (fruit fly):	Ets21C	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	fli1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fli1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	39,089,533 - 39,208,557 (-)	Ensembl				GRCr8
mRatBN7.2	8	30,831,422 - 30,950,468 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	34,903,577 - 35,021,956 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	33,197,989 - 33,316,402 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	31,060,872 - 31,179,270 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	33,541,932 - 33,661,111 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	32,284,160 - 32,401,673 (-)	NCBI		Celera
RGSC_v3.1	8	32,196,722 - 32,318,548 (-)	NCBI
Cytogenetic Map	8	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ewing sarcoma (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

hemorrhagic disease (ISO)

Jacobsen Syndrome (ISO)

medulloblastoma (ISO)

platelet-type bleeding disorder 15 (ISO)

Platelet-Type Bleeding Disorder 21 (ISO)

systemic scleroderma (ISS)

thrombocytopenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

anagrelide (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP,ISO)

cadmium dichloride (EXP,ISO)

choline (ISO)

chromium(6+) (ISO)

copper(II) chloride (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dimethylarsinic acid (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

indometacin (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

N-nitrosodimethylamine (EXP)

nickel sulfate (ISO)

oxaliplatin (EXP)

oxybenzone (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

romidepsin (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sulindac (EXP)

tetrachloromethane (ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tributylstannane (EXP)

trichostatin A (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ morphogenesis (ISO)

blood circulation (ISO)

cell differentiation (IBA)

megakaryocyte development (ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA,IEA)

Cellular Component

nuclear body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	FLI1 monoallelic expression combined with its hemizygous loss underlies Paris-Trousseau/Jacobsen thrombopenia.	Raslova H, etal., J Clin Invest. 2004 Jul;114(1):77-84.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10981960	PMID:12527908	PMID:16757682	PMID:17606295	PMID:17962413	PMID:21867929	PMID:26316623	PMID:28255014

Genomics

Comparative Map Data

Fli1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	39,089,533 - 39,208,557 (-)	Ensembl				GRCr8
mRatBN7.2	8	30,831,422 - 30,950,468 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	34,903,577 - 35,021,956 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	33,197,989 - 33,316,402 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	31,060,872 - 31,179,270 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	33,541,932 - 33,661,111 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	32,284,160 - 32,401,673 (-)	NCBI		Celera
RGSC_v3.1	8	32,196,722 - 32,318,548 (-)	NCBI
Cytogenetic Map	8	q21	NCBI

FLI1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	128,685,132 - 128,813,267 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	128,686,535 - 128,813,267 (+)	Ensembl			hg38	GRCh38
GRCh37	11	128,556,430 - 128,683,162 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	128,069,199 - 128,187,521 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	128,069,198 - 128,187,520	NCBI
Celera	11	125,728,561 - 125,849,286 (+)	NCBI		Celera
Cytogenetic Map	11	q24.3	NCBI
HuRef	11	124,504,750 - 124,631,960 (+)	NCBI		HuRef
CHM1_1	11	128,442,436 - 128,569,169 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	128,718,360 - 128,845,984 (+)	NCBI		T2T-CHM13v2.0

Fli1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	32,333,500 - 32,454,292 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	32,333,500 - 32,454,157 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	32,422,204 - 32,543,432 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	32,422,204 - 32,542,861 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	32,229,793 - 32,348,953 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	32,171,773 - 32,290,933 (-)	NCBI		MGSCv36	mm8
Celera	9	29,685,381 - 29,804,572 (-)	NCBI		Celera
Cytogenetic Map	9	A4	NCBI
cM Map	9	17.74	NCBI

Fli1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	29,654,459 - 29,775,903 (+)	Ensembl
ChiLan1.0	NW_004955412	29,653,621 - 29,773,412 (+)	NCBI	ChiLan1.0	ChiLan1.0

FLI1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	129,376,354 - 129,494,803 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	130,484,068 - 130,602,419 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	123,506,859 - 123,626,024 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	127,409,301 - 127,527,521 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	127,409,301 - 127,530,312 (+)	Ensembl			panPan2	panpan1.1

FLI1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	5,841,533 - 5,968,329 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	5,843,023 - 5,966,822 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	5,899,065 - 6,025,150 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	5,799,196 - 5,922,120 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	5,799,200 - 5,920,609 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	5,858,425 - 5,981,002 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	5,836,777 - 5,962,717 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	5,870,453 - 5,993,208 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fli1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	110,872,609 - 111,001,492 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936572	3,448,862 - 3,577,836 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936572	3,448,870 - 3,576,406 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FLI1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	55,612,901 - 55,749,778 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	55,612,905 - 55,749,784 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	61,707,515 - 61,810,415 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FLI1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	119,817,987 - 119,945,378 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	119,827,222 - 119,946,662 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	6,144,187 - 6,261,677 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fli1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624812	3,004,628 - 3,139,101 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624812	3,004,631 - 3,138,901 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fli1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	28,116,938 - 28,235,663 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fli1
1139 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	176
Count of miRNA genes:	135
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000068037
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	12964165	57964165	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	12964165	57964165	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	10382540	55382540	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	10382540	55382540	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	51589833	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	12964165	57964165	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	10382540	55382540	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	37760859	58991895	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	10382540	55382540	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	34125902	55607752	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	39106258	49610361	Rat

Markers in Region

D8Mit5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	39,106,258 - 39,106,363 (+)	Marker Load Pipeline
mRatBN7.2	8	30,848,154 - 30,848,259 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,558,660 - 33,558,764	NCBI	Rnor6.0
Rnor_5.0	8	33,603,024 - 33,603,128	UniSTS	Rnor5.0
RGSC_v3.4	8	32,203,394 - 32,203,499	RGD	RGSC3.4
RGSC_v3.4	8	32,203,395 - 32,203,499	UniSTS	RGSC3.4
Celera	8	32,299,483 - 32,299,583	UniSTS
RGSC_v3.1	8	32,212,161 - 32,212,265	RGD
RH 3.4 Map	8	248.5	RGD
RH 3.4 Map	8	248.5	UniSTS
RH 2.0 Map	8	167.4	RGD
Cytogenetic Map	8	q21	UniSTS

X59421

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,832,828 - 30,832,928 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,543,334 - 33,543,433	NCBI	Rnor6.0
Rnor_5.0	8	33,587,564 - 33,587,663	UniSTS	Rnor5.0
RGSC_v3.4	8	32,188,069 - 32,188,168	UniSTS	RGSC3.4
Celera	8	32,284,277 - 32,284,376	UniSTS
Cytogenetic Map	8	q21	UniSTS

RH138660

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,892,174 - 30,892,407 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,602,734 - 33,602,966	NCBI	Rnor6.0
Rnor_5.0	8	33,644,880 - 33,645,112	UniSTS	Rnor5.0
RGSC_v3.4	8	32,250,922 - 32,251,154	UniSTS	RGSC3.4
Celera	8	32,343,459 - 32,343,691	UniSTS
RH 3.4 Map	8	253.2	UniSTS
Cytogenetic Map	8	q21	UniSTS

Fli1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,832,911 - 30,833,057 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,543,417 - 33,543,562	NCBI	Rnor6.0
Rnor_5.0	8	33,587,647 - 33,587,792	UniSTS	Rnor5.0
RGSC_v3.4	8	32,188,152 - 32,188,297	UniSTS	RGSC3.4
Celera	8	32,284,360 - 32,284,505	UniSTS
Cytogenetic Map	8	q21	UniSTS

BF386415

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,930,560 - 30,930,712 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,641,183 - 33,641,334	NCBI	Rnor6.0
Rnor_5.0	8	33,683,329 - 33,683,480	UniSTS	Rnor5.0
RGSC_v3.4	8	32,289,916 - 32,290,067	UniSTS	RGSC3.4
Celera	8	32,381,833 - 32,381,984	UniSTS
RH 3.4 Map	8	254.2	UniSTS
Cytogenetic Map	8	q21	UniSTS

BF405592

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,930,799 - 30,931,015 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,641,422 - 33,641,637	NCBI	Rnor6.0
Rnor_5.0	8	33,683,568 - 33,683,783	UniSTS	Rnor5.0
RGSC_v3.4	8	32,290,155 - 32,290,370	UniSTS	RGSC3.4
Celera	8	32,382,072 - 32,382,287	UniSTS
RH 3.4 Map	8	253.5	UniSTS
Cytogenetic Map	8	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	142	81	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001017381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008766055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY972521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068037 ⟹ ENSRNOP00000059605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	39,089,533 - 39,208,557 (-)	Ensembl
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl
Rnor_6.0 Ensembl	8	33,543,258 - 33,661,049 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098203 ⟹ ENSRNOP00000085961

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	39,089,533 - 39,208,557 (-)	Ensembl
mRatBN7.2 Ensembl	8	30,832,753 - 30,950,433 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118943 ⟹ ENSRNOP00000097598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	39,089,533 - 39,178,651 (-)	Ensembl
mRatBN7.2 Ensembl	8	30,832,950 - 30,887,253 (-)	Ensembl

RefSeq Acc Id:

NM_001017381 ⟹ NP_001017381

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,533 - 39,208,557 (-)	NCBI
mRatBN7.2	8	30,831,429 - 30,950,468 (-)	NCBI
Rnor_6.0	8	33,543,217 - 33,661,049 (-)	NCBI
Rnor_5.0	8	33,586,162 - 33,704,455 (-)	NCBI
RGSC_v3.4	8	32,187,952 - 32,309,782 (-)	RGD
Celera	8	32,284,160 - 32,401,673 (-)	RGD

Sequence:

show sequence

CGGCACGAGGAGGACTTCCTCCCCGATCGCAAAGTGAAGTCACTTCCCAAAATTAGCTGAAAAA
AAGTTTCATCCGGTTAACTGTCTCTTTTTCGATCCGCTACAACAACAAACGTGCACAGGGGAGC
GAGGGCAGGGTGCTCACAGGGGGCACTCAGAGAGGGCCCAGGGCGCCAAAGAGGCCGCGCCGGG
CTAATCTGAAGGGGCTACGGGGTCAGGCTGTAACCGGGTCAATGTGTGGAATATTGGGGGGCTC
GGCTGCAGAATTGGCCAAATGGACGGGACTATTAAGGAGGCTCTGTCAGTGGTGAGTGACGACC
AGTCCCTTTTTGATTCAGCATACGGAGCGGCCGCCCATCTCCCCAAGGCAGATATGACTGCTTC
GGGGAGTCCTGACTACGGGCAGCCCCACAAAATCAACCCCCTGCCACCACAGCAGGAGTGGATC
AACCAGCCAGTGAGGGTCAATGTCAAGCGGGAATATGATCACATGAATGGATCCAGGGAGTCTC
CGGTGGACTGCAGTGTCAGCAAATGCAACAAGCTGGTGGGTGGAGGCGAAGCCAACCCCATGAA
CTACAATAGCTACATGGATGAGAAGAATGGCCCCCCTCCTCCCAACATGACCACCAACGAGCGG
AGAGTCATTGTGCCTGCAGACCCCACACTGTGGACACAGGAGCACGTTCGACAGTGGCTGGAGT
GGGCCATAAAGGAATATGGCTTGATGGAGATTGACACTTCCTTCTTCCAGAACATGGATGGCAA
GGAACTGTGTAAAATGAGCAAGGAGGACTTCCTCCGAGCCACCTCCCTCTACAACACAGAAGTG
CTGTTGTCGCACCTCAGTTACCTCAGGGAAAGTTCACTGCTGGCCTATAATACACCCTCCCACA
CAGACCAGTCCTCACGACTGAATGTCAAGGAAGACCCTTCTTATGACTCTGTCAGGAGAGGGGG
ATGGAGCAACAATATGAACTCTGGCATCAACAAAAGTCCTCCCCTTGGAGGAGCACAGAGCATG
GGCAAGAACACTGAGCAACGGCCCCAGCCAGATCCTTATCAGATCCTGGGGCCCACCAGCAGCC
GCCTAGCAAACCCTGGAAGTGGGCAGATCCAACTGTGGCAGTTTCTCCTGGAACTACTGTCTGA
CAGCGCCAACGCCAGTTGCATTACTTGGGAGGGGACCAACGGGGAATTCAAAATGACGGACCCT
GATGAGGTGGCCAGGCGCTGGGGAGAGCGGAAGAGCAAGCCCAACATGAATTACGATAAGCTGA
GCCGGGCCCTCCGATACTACTACGATAAAAACATTATGACCAAAGTGCATGGCAAAAGGTATGC
CTACAAGTTTGACTTCCATGGCATTGCCCAAGCCCTGCAGCCACACCCAACAGAGACATCAATG
TACAAGTATCCTTCTGACATCTCCTACATGCCTTCCTACCATGCCCATCAACAAAAGGTGAACT
TTGTCCAGCCCCACCCATCCTCCATGCCTGTCACCTCCTCCAGCTTCTTTGGAGCAGCGTCACA
ATACTGGACCTCCCCCACTGCGGGGATCTACCCGAACCCCAGTGTACCCCGCCATCCTAACACC
CACGTGCCTTCACACTTAGGCAGCTACTACTAGAACTTAACACCAGTTGGCCTTCTGGCTGAAG
TTCCAGCCCTCACTTCTACTGGATACTCTGGACTCTAAAAGATGCTGTAGCTTTGAAGAGATAA
GAAAACTGGATGTTCTTTCCTTTGGATAGAACCTTTGTACTTGTTCTTCTAAAAATGATTATTT
GTATGTTTAAAAAAAAAGAACTTTTGCTTCCTCTACCTAAAAAAGAAAAAAGAAAGAAAAAGAA
AGAAAGAAAGAAAAA

hide sequence

RefSeq Acc Id:

XM_063265407 ⟹ XP_063121477

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,209,414 (-)	NCBI

RefSeq Acc Id:

XM_063265408 ⟹ XP_063121478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,186,629 (-)	NCBI

RefSeq Acc Id:

XM_063265409 ⟹ XP_063121479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	39,089,526 - 39,209,511 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001017381	(Get FASTA)	NCBI Sequence Viewer
	XP_063121477	(Get FASTA)	NCBI Sequence Viewer
	XP_063121478	(Get FASTA)	NCBI Sequence Viewer
	XP_063121479	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX83256	(Get FASTA)	NCBI Sequence Viewer
	EDL83289	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059605
	ENSRNOP00000059605.1
	ENSRNOP00000085961
	ENSRNOP00000085961.1
	ENSRNOP00000097598
	ENSRNOP00000097598.2

RefSeq Acc Id:

NP_001017381 ⟸ NM_001017381

- UniProtKB:

Q4Z8P1 (UniProtKB/TrEMBL), F7FFL9 (UniProtKB/TrEMBL), A0A8I6ASZ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRV
NVKREYDHMNGSRESPVDCSVSKCNKLVGGGEANPMNYNSYMDEKNGPPPPNMTTNERRVIVPA
DPTLWTQEHVRQWLEWAIKEYGLMEIDTSFFQNMDGKELCKMSKEDFLRATSLYNTEVLLSHLS
YLRESSLLAYNTPSHTDQSSRLNVKEDPSYDSVRRGGWSNNMNSGINKSPPLGGAQSMGKNTEQ
RPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARR
WGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTETSMYKYPSD
ISYMPSYHAHQQKVNFVQPHPSSMPVTSSSFFGAASQYWTSPTAGIYPNPSVPRHPNTHVPSHL
GSYY

hide sequence

Ensembl Acc Id:

ENSRNOP00000059605 ⟸ ENSRNOT00000068037

Ensembl Acc Id:

ENSRNOP00000097598 ⟸ ENSRNOT00000118943

Ensembl Acc Id:

ENSRNOP00000085961 ⟸ ENSRNOT00000098203

RefSeq Acc Id:	XP_063121479 ⟸ XM_063265409
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6ASZ2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063121477 ⟸ XM_063265407
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A3J9 (UniProtKB/TrEMBL), A0A8I6ASZ2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063121478 ⟸ XM_063265408
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6ASZ2 (UniProtKB/TrEMBL)

Protein Domains

ETS PNT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4Z8P1-F1-model_v2	AlphaFold	Q4Z8P1	1-452	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695832

Promoter ID:

EPDNEW_R6356

Type:

multiple initiation site

Name:

Fli1_1

Description:

Fli-1 proto-oncogene, ETS transcription factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	33,660,974 - 33,661,034	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309837	AgrOrtholog
BioCyc Gene	G2FUF-31234	BioCyc
Ensembl Genes	ENSRNOG00000008904	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000068037	ENTREZGENE
	ENSRNOT00000068037.3	UniProtKB/TrEMBL
	ENSRNOT00000098203	ENTREZGENE
	ENSRNOT00000098203.2	UniProtKB/TrEMBL
	ENSRNOT00000118943	ENTREZGENE
	ENSRNOT00000118943.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
	1.10.150.50	UniProtKB/TrEMBL
InterPro	Ets	UniProtKB/TrEMBL
	ETS_fam	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
	SAM_PNT-FLI-1	UniProtKB/TrEMBL
	SAM_type	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:315532	UniProtKB/TrEMBL
NCBI Gene	315532	ENTREZGENE
PANTHER	PTHR11849	UniProtKB/TrEMBL
	PTHR11849:SF161	UniProtKB/TrEMBL
Pfam	Ets	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
PhenoGen	Fli1	PhenoGen
PRINTS	ETSDOMAIN	UniProtKB/TrEMBL
PROSITE	ETS_DOMAIN_1	UniProtKB/TrEMBL
	ETS_DOMAIN_2	UniProtKB/TrEMBL
	ETS_DOMAIN_3	UniProtKB/TrEMBL
	PNT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008904	RatGTEx
SMART	ETS	UniProtKB/TrEMBL
	SAM_PNT	UniProtKB/TrEMBL
Superfamily-SCOP	SAM_homology	UniProtKB/TrEMBL
	SSF46785	UniProtKB/TrEMBL
UniProt	A0A8I6A3J9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ASZ2	ENTREZGENE, UniProtKB/TrEMBL
	F7FFL9	ENTREZGENE, UniProtKB/TrEMBL
	Q4Z8P1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Fli1	Fli-1 proto-oncogene, ETS transcription factor	LOC100910769	Friend leukemia integration 1 transcription factor-like	Data merged from RGD:6496556	737654	PROVISIONAL
2013-08-14	Fli1	Fli-1 proto-oncogene, ETS transcription factor	Fli1	Friend leukemia virus integration 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100910769	Friend leukemia integration 1 transcription factor-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-24	Fli1	Friend leukemia virus integration 1	Fli1	Friend leukemia integration 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Fli1	Friend leukemia integration 1	Fli1_predicted	Friend leukemia integration 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Fli1_predicted	Friend leukemia integration 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM