Symbol:
Top3b
Name:
DNA topoisomerase III beta
RGD ID:
1309468
Description:
Predicted to enable DNA topoisomerase type I (single strand cut, ATP-independent) activity and RNA topoisomerase activity. Predicted to be involved in DNA recombination; DNA repair; and DNA topological change. Predicted to act upstream of or within chromosome segregation. Predicted to be located in condensed chromosome. Predicted to be part of DNA topoisomerase III-beta-TDRD3 complex. Predicted to be active in nucleus. Orthologous to human TOP3B (DNA topoisomerase III beta); PARTICIPATES IN homologous recombination pathway of double-strand break repair; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
DNA topoisomerase 3-beta-1; LOC287930; topoisomerase (DNA) III beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TOP3B (DNA topoisomerase III beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Top3b (topoisomerase (DNA) III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Top3b (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TOP3B (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TOP3B (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Top3b (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TOP3B (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TOP3B (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Top3b (DNA topoisomerase III beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IFT22 (intraflagellar transport 22) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TOP3B (DNA topoisomerase III beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Top3b (topoisomerase (DNA) III beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
top3b (DNA topoisomerase III beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y48C3A.14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Top3beta
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
top3b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 97,601,223 - 97,629,678 (-) NCBI GRCr8 mRatBN7.2 11 84,097,018 - 84,125,474 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 84,097,026 - 84,125,392 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 92,821,137 - 92,849,383 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 85,482,270 - 85,510,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 84,535,862 - 84,564,108 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 88,346,305 - 88,374,896 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 88,346,313 - 88,374,679 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 91,401,389 - 91,429,964 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 86,116,936 - 86,145,314 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 86,157,538 - 86,185,850 (-) NCBI Celera 11 82,851,647 - 82,880,025 (-) NCBI Celera Cytogenetic Map 11 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Top3b Rat (S)-amphetamine decreases expression ISO Top3b (Mus musculus) 6480464 Dextroamphetamine results in decreased expression of TOP3B mRNA CTD PMID:12558987 Top3b Rat 1,2-dimethylhydrazine multiple interactions ISO Top3b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOP3B mRNA CTD PMID:22206623 Top3b Rat 17beta-estradiol increases expression ISO Top3b (Mus musculus) 6480464 Estradiol results in increased expression of TOP3B mRNA CTD PMID:39298647 Top3b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Top3b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TOP3B mRNA CTD PMID:19465110 Top3b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TOP3B mRNA CTD PMID:33387578 Top3b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Top3b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TOP3B mRNA CTD PMID:21570461 Top3b Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TOP3B mRNA CTD PMID:21346803 Top3b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TOP3B mRNA CTD PMID:21346803 Top3b Rat 3,4-methylenedioxymethamphetamine increases expression ISO Top3b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TOP3B mRNA CTD PMID:20188158 Top3b Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Top3b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TOP3B mRNA CTD PMID:26251327 Top3b Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TOP3B protein CTD PMID:34915118 Top3b Rat 4,4'-diaminodiphenylmethane increases expression ISO Top3b (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TOP3B mRNA CTD PMID:18648102 Top3b Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOP3B mRNA CTD PMID:36041667 Top3b Rat acetylsalicylic acid increases expression ISO TOP3B (Homo sapiens) 6480464 Aspirin results in increased expression of TOP3B mRNA CTD PMID:11906190 Top3b Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of TOP3B mRNA CTD PMID:28959563 Top3b Rat aflatoxin B1 increases expression ISO Top3b (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of TOP3B mRNA CTD PMID:19770486 Top3b Rat aflatoxin B1 increases methylation ISO TOP3B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TOP3B gene CTD PMID:27153756 Top3b Rat avobenzone increases expression ISO TOP3B (Homo sapiens) 6480464 avobenzone results in increased expression of TOP3B mRNA CTD PMID:31016361 Top3b Rat benzo[a]pyrene decreases expression ISO TOP3B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TOP3B mRNA CTD PMID:20106945 Top3b Rat beta-lapachone increases expression ISO TOP3B (Homo sapiens) 6480464 beta-lapachone results in increased expression of TOP3B mRNA CTD PMID:38218311 Top3b Rat beta-lapachone decreases expression ISO TOP3B (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TOP3B mRNA CTD PMID:38218311 Top3b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TOP3B mRNA CTD PMID:25181051 Top3b Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOP3B mRNA CTD PMID:36041667 Top3b Rat bisphenol A decreases methylation ISO TOP3B (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TOP3B gene CTD PMID:31601247 Top3b Rat bisphenol A decreases expression ISO Top3b (Mus musculus) 6480464 bisphenol A results in decreased expression of TOP3B mRNA CTD PMID:38074096 Top3b Rat Bisphenol A diglycidyl ether affects splicing ISO Top3b (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of TOP3B mRNA CTD PMID:36464114 Top3b Rat bisphenol AF affects splicing ISO Top3b (Mus musculus) 6480464 bisphenol AF affects the splicing of TOP3B mRNA CTD PMID:36464114 Top3b Rat bisphenol F decreases expression ISO Top3b (Mus musculus) 6480464 bisphenol F results in decreased expression of TOP3B mRNA CTD PMID:38685157 Top3b Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TOP3B mRNA CTD PMID:36041667 Top3b Rat cadmium atom decreases expression ISO Top3b (Mus musculus) 6480464 Cadmium results in decreased expression of TOP3B mRNA CTD PMID:24067728 Top3b Rat cadmium dichloride multiple interactions ISO Top3b (Mus musculus) 6480464 MT3 affects the reaction [Cadmium Chloride affects the expression of TOP3B mRNA] CTD PMID:20371981 Top3b Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TOP3B mRNA CTD PMID:33453195 Top3b Rat cyclosporin A increases methylation ISO TOP3B (Homo sapiens) 6480464 Cyclosporine results in increased methylation of TOP3B promoter CTD PMID:27989131 Top3b Rat dicrotophos increases expression ISO TOP3B (Homo sapiens) 6480464 dicrotophos results in increased expression of TOP3B mRNA CTD PMID:28302478 Top3b Rat disodium selenite decreases expression ISO TOP3B (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of TOP3B mRNA CTD PMID:18175754 Top3b Rat epoxiconazole decreases expression ISO Top3b (Mus musculus) 6480464 epoxiconazole results in decreased expression of TOP3B mRNA CTD PMID:35436446 Top3b Rat folic acid multiple interactions ISO Top3b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOP3B mRNA CTD PMID:22206623 Top3b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TOP3B mRNA CTD PMID:33387578 Top3b Rat N-methyl-N-nitrosourea decreases expression ISO Top3b (Mus musculus) 6480464 Methylnitrosourea results in decreased expression of TOP3B mRNA CTD PMID:16616109 Top3b Rat N-methyl-N-nitrosourea increases expression ISO Top3b (Mus musculus) 6480464 Methylnitrosourea results in increased expression of TOP3B mRNA CTD PMID:25270620 Top3b Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TOP3B mRNA CTD PMID:33387578 Top3b Rat potassium bromate decreases expression ISO TOP3B (Homo sapiens) 6480464 potassium bromate results in decreased expression of TOP3B mRNA CTD PMID:22539617 Top3b Rat sunitinib decreases expression ISO TOP3B (Homo sapiens) 6480464 Sunitinib results in decreased expression of TOP3B mRNA CTD PMID:31533062 Top3b Rat titanium dioxide decreases methylation ISO Top3b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TOP3B gene and titanium dioxide results in decreased methylation of TOP3B promoter alternative form CTD PMID:35295148 Top3b Rat valproic acid decreases expression ISO Top3b (Mus musculus) 6480464 Valproic Acid results in decreased expression of TOP3B mRNA CTD PMID:19136453 Top3b Rat valproic acid increases methylation ISO TOP3B (Homo sapiens) 6480464 Valproic Acid results in increased methylation of TOP3B gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
(S)-amphetamine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) acetylsalicylic acid (ISO) acrylamide (EXP) aflatoxin B1 (ISO) avobenzone (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cyclosporin A (ISO) dicrotophos (ISO) disodium selenite (ISO) epoxiconazole (ISO) folic acid (ISO) gentamycin (EXP) N-methyl-N-nitrosourea (ISO) paracetamol (EXP) potassium bromate (ISO) sunitinib (ISO) titanium dioxide (ISO) valproic acid (ISO)
Top3b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 97,601,223 - 97,629,678 (-) NCBI GRCr8 mRatBN7.2 11 84,097,018 - 84,125,474 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 84,097,026 - 84,125,392 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 92,821,137 - 92,849,383 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 85,482,270 - 85,510,510 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 84,535,862 - 84,564,108 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 88,346,305 - 88,374,896 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 88,346,313 - 88,374,679 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 91,401,389 - 91,429,964 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 86,116,936 - 86,145,314 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 86,157,538 - 86,185,850 (-) NCBI Celera 11 82,851,647 - 82,880,025 (-) NCBI Celera Cytogenetic Map 11 q23 NCBI
TOP3B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 21,957,025 - 21,982,787 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 21,957,025 - 21,982,813 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 22,311,397 - 22,337,184 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 20,641,403 - 20,667,147 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 20,635,957 - 20,661,701 NCBI Celera 22 6,128,944 - 6,154,663 (-) NCBI Celera Cytogenetic Map 22 q11.22 NCBI HuRef 22 5,268,479 - 5,294,196 (-) NCBI HuRef CHM1_1 22 22,311,501 - 22,337,220 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 22,370,556 - 22,396,320 (-) NCBI T2T-CHM13v2.0
Top3b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 16,688,587 - 16,710,850 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 16,688,600 - 16,710,854 (+) Ensembl GRCm39 Ensembl GRCm38 16 16,870,722 - 16,892,986 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 16,870,736 - 16,892,990 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 16,870,984 - 16,893,079 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 16,784,454 - 16,806,549 (+) NCBI MGSCv36 mm8 Celera 16 17,442,801 - 17,464,977 (+) NCBI Celera Cytogenetic Map 16 A3 NCBI cM Map 16 10.46 NCBI
Top3b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 17,200,453 - 17,225,335 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 17,201,079 - 17,223,824 (+) NCBI ChiLan1.0 ChiLan1.0
TOP3B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 31,498,751 - 31,524,557 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 34,047,630 - 34,073,423 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 4,076,295 - 4,102,086 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 20,557,248 - 20,583,307 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 20,557,248 - 20,583,464 (-) Ensembl panpan1.1 panPan2
TOP3B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 31,198,371 - 31,223,133 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 31,198,382 - 31,215,134 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 31,154,388 - 31,178,817 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 32,604,302 - 32,628,806 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 32,604,310 - 32,628,701 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 30,652,585 - 30,677,122 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 30,276,606 - 30,301,211 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 31,367,160 - 31,391,836 (-) NCBI UU_Cfam_GSD_1.0
Top3b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 140,971,807 - 140,997,296 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936619 1,756,791 - 1,785,953 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936619 1,756,829 - 1,782,063 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TOP3B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 50,020,509 - 50,037,856 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 50,020,412 - 50,037,854 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 53,462,935 - 53,480,381 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TOP3B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 4,137,823 - 4,163,860 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 4,137,862 - 4,166,436 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666085 2,836,805 - 2,865,520 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Top3b
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 98 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000002524 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 1354593 Stl12 Serum triglyceride level QTL 12 3.36 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 11 66422148 86241447 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 634339 Niddm50 Non-insulin dependent diabetes mellitus QTL 50 3.32 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 66422148 86241447 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002524 ⟹ ENSRNOP00000002524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 84,097,026 - 84,125,392 (-) Ensembl Rnor_6.0 Ensembl 11 88,346,313 - 88,374,679 (-) Ensembl
RefSeq Acc Id:
NM_001105861 ⟹ NP_001099331
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,597 (-) NCBI mRatBN7.2 11 84,097,018 - 84,125,392 (-) NCBI Rnor_6.0 11 88,346,305 - 88,374,679 (-) NCBI Rnor_5.0 11 91,401,389 - 91,429,964 (-) NCBI RGSC_v3.4 11 86,116,936 - 86,145,314 (-) RGD Celera 11 82,851,647 - 82,880,025 (-) RGD
Sequence:
ACAGAGCCGGAAGTGCGTTCGTGAGTGGCCACCGGGAAAGCACGGCCGGAGCGAGAGGTGCAGCGGCACGGCGGGTTTCAAGTGATATACCCTGCCCAGAAAGCTACAGCAGAGGCCAACAGTGGTCC
hide sequence
RefSeq Acc Id:
XM_006248671 ⟹ XP_006248733
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,678 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,474 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,896 (-) NCBI Rnor_5.0 11 91,401,389 - 91,429,964 (-) NCBI
Sequence:
ATCAGTTTTCATCATCATACTGACAATCGTCATTATTGTCCTCTGGATAGTTTTTGGAAGACCA
hide sequence
RefSeq Acc Id:
XM_006248673 ⟹ XP_006248735
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,441 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,233 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,530 (-) NCBI Rnor_5.0 11 91,401,389 - 91,429,964 (-) NCBI
Sequence:
GAGCTCCGACCCGGGTGGGGGCGTGGGGGAGGGTCCTTGCCTGGTGCGGCTTTTTCCCGGTCCCGCCCTCGCTTCGGGTGGGACCGAGTTTAGTGGGCGACTGTCGCTCCACCGAGCTCCCCGCGGCC
hide sequence
RefSeq Acc Id:
XM_017597893 ⟹ XP_017453382
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,594 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,393 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,896 (-) NCBI
Sequence:
ATCAGTTTTCATCATCATACTGACAATCGTCATTATTGTCCTCTGGATAGTTTTTGGAAGACCA
hide sequence
RefSeq Acc Id:
XM_017597894 ⟹ XP_017453383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,583 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,379 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,896 (-) NCBI
Sequence:
ATCAGTTTTCATCATCATACTGACAATCGTCATTATTGTCCTCTGGATAGTTTTTGGAAGACCA
hide sequence
RefSeq Acc Id:
XM_017597895 ⟹ XP_017453384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,576 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,379 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,896 (-) NCBI
Sequence:
ATCAGTTTTCATCATCATACTGACAATCGTCATTATTGTCCTCTGGATAGTTTTTGGAAGACCAACTCCAGGCTGAGGGAAGACACACAACGGAGACTTGGACCCTCCTGCACCTAACAAGATGCAGA
hide sequence
RefSeq Acc Id:
XM_017597896 ⟹ XP_017453385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,479 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,073 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,366 (-) NCBI
Sequence:
AAACTGGCTCAGGGAAGCCTTGCTGCCCACAAAAGCTCGGGCCTGCGGTCCGCGTTCTTAGTCG
hide sequence
RefSeq Acc Id:
XM_017597897 ⟹ XP_017453386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,483 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,230 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,530 (-) NCBI
Sequence:
GAGCTCCGACCCGGGTGGGGGCGTGGGGGAGGGTCCTTGCCTGGTGCGGCTTTTTCCCGGTCCC
hide sequence
RefSeq Acc Id:
XM_017597898 ⟹ XP_017453387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,477 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,239 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,530 (-) NCBI
Sequence:
GAGCTCCGACCCGGGTGGGGGCGTGGGGGAGGGTCCTTGCCTGGTGCGGCTTTTTCCCGGTCCC
hide sequence
RefSeq Acc Id:
XM_017597899 ⟹ XP_017453388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,458 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,069 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,366 (-) NCBI
Sequence:
AAACTGGCTCAGGGAAGCCTTGCTGCCCACAAAAGCTCGGGCCTGCGGTCCGCGTTCTTAGTCG
hide sequence
RefSeq Acc Id:
XM_017597900 ⟹ XP_017453389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,598 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,400 (-) NCBI Rnor_6.0 11 88,346,311 - 88,374,896 (-) NCBI
Sequence:
ATCAGTTTTCATCATCATACTGACAATCGTCATTATTGTCCTCTGGATAGTTTTTGGAAGACCA
hide sequence
RefSeq Acc Id:
XM_039088060 ⟹ XP_038943988
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,480 (-) NCBI mRatBN7.2 11 84,097,024 - 84,124,908 (-) NCBI
RefSeq Acc Id:
XM_039088061 ⟹ XP_038943989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,629,480 (-) NCBI mRatBN7.2 11 84,097,024 - 84,125,068 (-) NCBI
RefSeq Acc Id:
XM_039088063 ⟹ XP_038943991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,607,560 (-) NCBI mRatBN7.2 11 84,097,024 - 84,106,524 (-) NCBI
RefSeq Acc Id:
XM_063270319 ⟹ XP_063126389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,601,223 - 97,626,614 (-) NCBI
RefSeq Acc Id:
XR_005490986
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,603,980 - 97,629,594 (-) NCBI mRatBN7.2 11 84,099,787 - 84,125,392 (-) NCBI
RefSeq Acc Id:
XR_005490987
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,603,999 - 97,629,594 (-) NCBI mRatBN7.2 11 84,099,797 - 84,125,392 (-) NCBI
RefSeq Acc Id:
XR_005490988
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 97,604,778 - 97,629,594 (-) NCBI mRatBN7.2 11 84,100,573 - 84,125,392 (-) NCBI
RefSeq Acc Id:
NP_001099331 ⟸ NM_001105861
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_006248733 ⟸ XM_006248671
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_006248735 ⟸ XM_006248673
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453382 ⟸ XM_017597893
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453389 ⟸ XM_017597900
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453383 ⟸ XM_017597894
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453384 ⟸ XM_017597895
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453387 ⟸ XM_017597898
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453386 ⟸ XM_017597897
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453385 ⟸ XM_017597896
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
RefSeq Acc Id:
XP_017453388 ⟸ XM_017597899
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
- Sequence:
MKTVLMVAEKPSLAQSIAKILSRGNMSSHKGLNGACSVHKYTGTFAGQPVHFKMTSVCGHVMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYVVLWLDCDKEGENICFE
hide sequence
Ensembl Acc Id:
ENSRNOP00000002524 ⟸ ENSRNOT00000002524
RefSeq Acc Id:
XP_038943989 ⟸ XM_039088061
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038943988 ⟸ XM_039088060
- Peptide Label:
isoform X1
- UniProtKB:
D4A9Z2 (UniProtKB/TrEMBL), A6JSP3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038943991 ⟸ XM_039088063
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063126389 ⟸ XM_063270319
- Peptide Label:
isoform X1
- UniProtKB:
A6JSP3 (UniProtKB/TrEMBL), D4A9Z2 (UniProtKB/TrEMBL)
RGD ID: 13698341 Promoter ID: EPDNEW_R8866 Type: multiple initiation site Name: Top3b_1 Description: DNA topoisomerase III beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 88,374,669 - 88,374,729 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-08-16
Top3b
DNA topoisomerase III beta
Top3b
topoisomerase (DNA) III beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Top3b
topoisomerase (DNA) III beta
Top3b_predicted
topoisomerase (DNA) III beta (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Top3b_predicted
topoisomerase (DNA) III beta (predicted)
Symbol and Name status set to approved
70820 APPROVED
