Advanced Search (OLGA)

Gene: Rfc5 (replication factor C subunit 5) Rattus norvegicus

Analyze

Symbol:

Rfc5

Name:

replication factor C subunit 5

RGD ID:

1309280

Description:

Predicted to enable enzyme binding activity. Predicted to contribute to DNA clamp loader activity and single-stranded DNA helicase activity. Predicted to be involved in DNA repair and DNA-templated DNA replication. Predicted to be part of Ctf18 RFC-like complex and DNA replication factor C complex. Predicted to be active in nucleus. Orthologous to human RFC5 (replication factor C subunit 5); PARTICIPATES IN mismatch repair pathway; nucleotide excision repair pathway; DNA replication pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC304528; replication factor C (activator 1) 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RFC5 (replication factor C subunit 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rfc5 (replication factor C (activator 1) 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rfc5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RFC5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RFC5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rfc5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RFC5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RFC5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rfc5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rfc5 (replication factor C subunit 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF655 (zinc finger protein 655)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RFC5 (replication factor C subunit 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rfc5 (replication factor C (activator 1) 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rfc5 (replication factor C (activator 1) 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F44B9.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RFC3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RfC3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rfc5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rfc5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	44,868,322 - 44,877,879 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	44,862,329 - 44,878,151 (+)	Ensembl				GRCr8
mRatBN7.2	12	39,207,484 - 39,217,041 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	39,207,484 - 39,217,312 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	40,382,784 - 40,392,340 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	40,996,594 - 41,006,150 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	40,049,569 - 40,059,125 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	44,931,494 - 44,941,051 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	44,931,494 - 44,941,324 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	46,752,012 - 46,761,569 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	40,395,942 - 40,405,498 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	40,850,700 - 40,860,283 (+)	NCBI		Celera
RGSC_v3.1	12	40,239,703 - 40,268,387 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP,ISO)

all-trans-retinoic acid (ISO)

AM-251 (ISO)

arsenite(3-) (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clozapine (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

DDE (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

flutamide (EXP)

folic acid (ISO)

glyphosate (ISO)

isoprenaline (ISO)

ivermectin (ISO)

Lasiocarpine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methyl methanesulfonate (ISO)

methylseleninic acid (ISO)

microcystin RR (ISO)

monocrotaline (ISO)

N-nitrosodiethylamine (ISO)

ochratoxin A (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paclitaxel (ISO)

palbociclib (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctanoic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

piroxicam (ISO)

propiconazole (ISO)

resveratrol (ISO)

riddelliine (ISO)

rotenone (ISO)

SB 431542 (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

Soman (EXP)

tamibarotene (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA repair (IBA)

DNA replication (IEA)

DNA-templated DNA replication (IBA,IEA,ISO)

positive regulation of DNA-directed DNA polymerase activity (ISO)

Cellular Component

Ctf18 RFC-like complex (IEA,ISO)

DNA replication factor C complex (IBA,IEA,ISO)

nucleus (IBA,IEA)

Rad17 RFC-like complex (IEA,ISO)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

DNA binding (IEA)

DNA clamp loader activity (IBA,IEA,ISO)

enzyme binding (IEA,ISO)

nucleotide binding (IEA)

protein binding (ISO)

single-stranded DNA helicase activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

DNA replication pathway (IEA)

mismatch repair pathway (IEA,ISO)

nucleotide excision repair pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Replication clamps and clamp loaders.	Hedglin M, etal., Cold Spring Harb Perspect Biol. 2013 Apr 1;5(4):a010165. doi: 10.1101/cshperspect.a010165.
4.	Mechanisms and functions of DNA mismatch repair.	Li GM Cell Res. 2008 Jan;18(1):85-98.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9488738	PMID:12477932	PMID:12930902	PMID:24115439

Genomics

Comparative Map Data

Rfc5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	44,868,322 - 44,877,879 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	44,862,329 - 44,878,151 (+)	Ensembl				GRCr8
mRatBN7.2	12	39,207,484 - 39,217,041 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	39,207,484 - 39,217,312 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	40,382,784 - 40,392,340 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	40,996,594 - 41,006,150 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	40,049,569 - 40,059,125 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	44,931,494 - 44,941,051 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	44,931,494 - 44,941,324 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	46,752,012 - 46,761,569 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	40,395,942 - 40,405,498 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	40,850,700 - 40,860,283 (+)	NCBI		Celera
RGSC_v3.1	12	40,239,703 - 40,268,387 (+)	NCBI
Cytogenetic Map	12	q16	NCBI

RFC5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	118,016,703 - 118,041,448 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	118,013,588 - 118,033,545 (+)	Ensembl			hg38	GRCh38
GRCh37	12	118,454,508 - 118,470,039 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	116,938,893 - 116,954,422 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	116,917,229 - 116,932,758	NCBI
Celera	12	118,085,448 - 118,100,501 (+)	NCBI		Celera
Cytogenetic Map	12	q24.23	NCBI
HuRef	12	115,465,092 - 115,480,369 (+)	NCBI		HuRef
CHM1_1	12	118,422,177 - 118,437,716 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	118,003,997 - 118,021,853 (+)	NCBI		T2T-CHM13v2.0

Rfc5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	117,517,210 - 117,527,088 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	117,516,168 - 117,527,112 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	117,379,145 - 117,389,023 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	117,378,103 - 117,389,047 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	117,829,154 - 117,839,032 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	117,829,154 - 117,839,032 (-)	NCBI		MGSCv36	mm8
Celera	5	114,470,100 - 114,479,973 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	56.88	NCBI

Rfc5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	13,326,271 - 13,338,050 (-)	Ensembl
ChiLan1.0	NW_004955455	13,325,912 - 13,337,241 (-)	NCBI	ChiLan1.0	ChiLan1.0

RFC5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	126,080,598 - 126,096,663 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	126,076,978 - 126,093,033 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	115,595,398 - 115,611,442 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	118,973,645 - 118,990,308 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	118,973,560 - 118,990,308 (+)	Ensembl			panPan2	panpan1.1

RFC5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	14,428,661 - 14,439,641 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	14,428,695 - 14,438,986 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	14,421,469 - 14,432,516 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	14,690,209 - 14,701,425 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	14,690,256 - 14,700,770 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	14,655,104 - 14,666,296 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	14,727,103 - 14,738,138 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	14,762,460 - 14,773,488 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rfc5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	154,732,093 - 154,743,094 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	4,735,678 - 4,747,538 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	4,736,332 - 4,747,323 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RFC5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	34,629,951 - 34,642,585 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	34,630,374 - 34,642,598 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	36,791,707 - 36,804,213 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RFC5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	113,352,342 - 113,368,147 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	113,352,378 - 113,370,829 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	131,739,741 - 131,755,709 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rfc5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	15,442,328 - 15,454,550 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	15,441,338 - 15,454,577 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rfc5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	36,441,232 - 36,450,589 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rfc5
50 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	54
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000001498
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

D12Rat25

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	39,215,274 - 39,215,414 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	44,939,285 - 44,939,424	NCBI	Rnor6.0
Rnor_5.0	12	46,759,803 - 46,759,942	UniSTS	Rnor5.0
RGSC_v3.4	12	40,403,732 - 40,403,871	UniSTS	RGSC3.4
RGSC_v3.4	12	40,403,569 - 40,403,881	RGD	RGSC3.4
Celera	12	40,858,499 - 40,858,656	UniSTS
RGSC_v3.1	12	40,267,120 - 40,267,259	RGD
RH 3.4 Map	12	733.5	RGD
RH 3.4 Map	12	733.5	UniSTS
RH 2.0 Map	12	503.3	RGD
FHH x ACI Map	12	37.59	RGD
Cytogenetic Map	12	q16	UniSTS

RH133942

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	39,216,680 - 39,216,880 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	44,940,691 - 44,940,890	NCBI	Rnor6.0
Rnor_5.0	12	46,761,209 - 46,761,408	UniSTS	Rnor5.0
RGSC_v3.4	12	40,405,138 - 40,405,337	UniSTS	RGSC3.4
Celera	12	40,859,923 - 40,860,122	UniSTS
RH 3.4 Map	12	725.2	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001498 ⟹ ENSRNOP00000001498

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,862,329 - 44,878,151 (+)	Ensembl
mRatBN7.2 Ensembl	12	39,207,503 - 39,217,312 (+)	Ensembl
Rnor_6.0 Ensembl	12	44,931,494 - 44,941,062 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082150

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	44,935,543 - 44,936,879 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084747 ⟹ ENSRNOP00000073675

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,868,311 - 44,870,949 (+)	Ensembl
mRatBN7.2 Ensembl	12	39,207,484 - 39,210,111 (+)	Ensembl
Rnor_6.0 Ensembl	12	44,931,577 - 44,939,588 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085505 ⟹ ENSRNOP00000069100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	44,932,726 - 44,941,324 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123452 ⟹ ENSRNOP00000104555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,868,319 - 44,877,445 (+)	Ensembl

RefSeq Acc Id:

NM_001107146 ⟹ NP_001100616

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	44,868,322 - 44,877,879 (+)	NCBI
mRatBN7.2	12	39,207,484 - 39,217,041 (+)	NCBI
Rnor_6.0	12	44,931,494 - 44,941,051 (+)	NCBI
Rnor_5.0	12	46,752,012 - 46,761,569 (+)	NCBI
RGSC_v3.4	12	40,395,942 - 40,405,498 (+)	RGD
Celera	12	40,850,700 - 40,860,283 (+)	RGD

Sequence:

show sequence

GCGAAGACTCGCGAGGGTTGGTTTGCGCGCGGACTCCGAGTCCAGTGGTTCGGTGGCCGGTCCC
TGCAGCATCTGTCAGTCATGGCGGCGGCGCCTTCGCAGCAGCAGCCCCGGGCGGCCCGGGCCCG
GAACCTGCCCTGGGTTGAGAAGTACCGGCCACAGACTCTGGCCGATCTCATATCTCACCAGGAC
ATCCTGAGTACCATTCAGAAGTTCATCAGTGAAGACCGCTTGCCACACCTACTTCTCTATGGCC
CTCCAGGCACAGGAAAGACATCCACCATTCTGGCCTGTGCCAAGCAACTGTACAAAGATAAAGA
ATTCGGCTCCATGGTCTTGGAGCTGAATGCTTCCGACGACCGAGGGATCGATATTGTCCGGGGG
CCAATCCTCAGCTTTGCCAGCACAAGGACAATCTTCAAGAGAGGGTTTAAGCTTGTGATCCTGG
ACGAAGCTGACGCCATGACTCAAGATGCCCAGAATGCCTTGAGACGAGTGATTGAGAAGTTCAC
TGAAAACACCAGGTTTTGCCTCATCTGTAACTACCTGTCCAAGATCATCCCTGCCTTGCAGTCA
CGGTGCACGAGGTTCCGATTTGGCCCTCTGACGCCTGAGCTCATGGTTCCTCGGCTAGAACATG
TGGTACAAGAAGAGAACGTGGACATAAGTGAAGATGGAATGAAGGCCCTTGTCACTCTGTCCAG
TGGGGACATGCGAAGGGCTTTGAACATTCTGCAGAGTACCAATATGGCCTTTGGGAAGGTGACA
GAGGAGACTGTCTACACCTGCACCGGGCACCCACTCAAGACGGATATTGCCAATATTCTAGACT
GGATGCTGAATCAAGACTTCACCACTGCCTACAAAAATATCATGGAGCTGAAGACTCTGAAGGG
CTTGGCACTGCACGACATCTTGACAGAGGTTCACTTGTTTGTGCACAGAGTTGACTTTCCGTCT
TCAGTTCGGATGCATTTATTGACCAAAATGGCAGACATTGAGTACAGGCTCTCTGTCGGCACCA
GTGAGAAGATCCAGCTGAGCTCCCTCATTGCTGCTTTTCAAGTTACCAGGGACTTGATAGTTGC
AGAGGCCTAGAAAACCCAAGGCCTGAGTTGCAGAAGCCTAGAAACTTGGCCCTTGCTCAGGCCC
ATCGGTGACTGGAGGACAGAAGACATGCTGCCCTGGGCCAGTGGATAAAATCAGTCACAGACTT
TTCTCCCCAGGCATTTAGATAGTGCTATCTGTGGCTGTTTGGAGCAGGGATCTACAGAGCAACT
TTAATCTGGAAGAATCCATTCTGCTTGTCTTCTATAGGGGAAAATACCCCGCCCCGTGGAGAGG
GCTGCTTTAAAGTCGTCACTGTCACTCTCTGGGATGACAAAATTGGCTGCAGTGTTCATGTGGA
AACTGAGTGTGCTTCAGTGTCTCCCAACTCTGAATGGGTGCCAGGAGGATTCTGATCTAATGTT
TTGTTAAGAATTTCAAAATCAGGGGTTGGGAATTTAGCTCAGTGGTAGAGCGCTTACCTAGGAA
GCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAAAAGAACCAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100616	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68902	(Get FASTA)	NCBI Sequence Viewer
	EDM13825	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001498
	ENSRNOP00000001498.6
	ENSRNOP00000073675.2
	ENSRNOP00000104555.1

RefSeq Acc Id:

NP_001100616 ⟸ NM_001107146

- UniProtKB:

B5DF29 (UniProtKB/TrEMBL), F1LQL0 (UniProtKB/TrEMBL), A0A9K3Y789 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAPSQQQPRAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPGTGK
TSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKRGFKLVILDEADAM
TQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVQEEN
VDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKTDIANILDWMLNQD
FTTAYKNIMELKTLKGLALHDILTEVHLFVHRVDFPSSVRMHLLTKMADIEYRLSVGTSEKIQL
SSLIAAFQVTRDLIVAEA

hide sequence

Ensembl Acc Id:

ENSRNOP00000073675 ⟸ ENSRNOT00000084747

Ensembl Acc Id:

ENSRNOP00000069100 ⟸ ENSRNOT00000085505

Ensembl Acc Id:

ENSRNOP00000001498 ⟸ ENSRNOT00000001498

Ensembl Acc Id:

ENSRNOP00000104555 ⟸ ENSRNOT00000123452

Protein Domains

AAA+ ATPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DF29-F1-model_v2	AlphaFold	B5DF29	1-338	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698674

Promoter ID:

EPDNEW_R9199

Type:

initiation region

Name:

Rfc5_1

Description:

replication factor C subunit 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	44,931,568 - 44,931,628	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309280	AgrOrtholog
BioCyc Gene	G2FUF-19064	BioCyc
Ensembl Genes	ENSRNOG00000001134	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001498	ENTREZGENE
	ENSRNOT00000001498.9	UniProtKB/TrEMBL
	ENSRNOT00000084747.3	UniProtKB/TrEMBL
	ENSRNOT00000123452.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.60	UniProtKB/TrEMBL
	1.20.272.10	UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/TrEMBL
InterPro	ATPase_AAA+_core	UniProtKB/TrEMBL
	ATPase_AAA_core	UniProtKB/TrEMBL
	DNA_pol3_clamp-load_cplx_C	UniProtKB/TrEMBL
	DNA_Rep/Repair_Clamp_Loader	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	Rep_factor-C	UniProtKB/TrEMBL
	RFC_lid	UniProtKB/TrEMBL
KEGG Report	rno:304528	UniProtKB/TrEMBL
NCBI Gene	304528	ENTREZGENE
PANTHER	REPLICATION FACTOR C / DNA POLYMERASE III GAMMA-TAU SUBUNIT	UniProtKB/TrEMBL
	REPLICATION FACTOR C SUBUNIT 5	UniProtKB/TrEMBL
Pfam	AAA	UniProtKB/TrEMBL
	Rad17	UniProtKB/TrEMBL
	RCF1-5-like_lid	UniProtKB/TrEMBL
	Rep_fac_C	UniProtKB/TrEMBL
PhenoGen	Rfc5	PhenoGen
RatGTEx	ENSRNOG00000001134	RatGTEx
SMART	AAA	UniProtKB/TrEMBL
Superfamily-SCOP	Pol_clamp_load_C	UniProtKB/TrEMBL
	SSF52540	UniProtKB/TrEMBL
UniProt	A0A0G2K649_RAT	UniProtKB/TrEMBL
	A0A9K3Y789	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LRK2_RAT	UniProtKB/TrEMBL
	B5DF29	ENTREZGENE, UniProtKB/TrEMBL
	F1LQL0	ENTREZGENE
UniProt Secondary	F1LQL0	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-16	Rfc5	replication factor C subunit 5	Rfc5	replication factor C (activator 1) 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Rfc5	replication factor C (activator 1) 5	Rfc5_predicted	replication factor C (activator 1) 5 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rfc5_predicted	replication factor C (activator 1) 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)