Symbol:
Dym
Name:
dymeclin
RGD ID:
1309111
Description:
Predicted to enable enzyme binding activity. Predicted to be involved in Golgi organization and bone development. Predicted to be located in cytoplasm. Predicted to be active in Golgi apparatus. Human ortholog(s) of this gene implicated in Dyggve-Melchior-Clausen disease; Smith-McCort dysplasia 1; and osteochondrodysplasia. Orthologous to human DYM (dymeclin); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bis(2-chloroethyl) sulfide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC291433; RGD1309111; similar to RIKEN cDNA 4933427L07
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DYM (dymeclin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dym (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dym (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DYM (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DYM (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dym (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DYM (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DYM (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dym (dymeclin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DYM (dymeclin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dym (dymeclin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dym (dymeclin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C47D12.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG8230
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dym
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 70,879,835 - 71,176,006 (+) NCBI GRCr8 mRatBN7.2 18 68,605,131 - 68,900,905 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 68,605,185 - 68,900,903 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 70,718,041 - 71,013,638 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 71,386,410 - 71,683,811 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 69,244,060 - 69,539,675 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 70,996,074 - 71,313,033 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 70,996,044 - 71,313,084 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 70,178,416 - 70,449,688 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 71,889,053 - 72,188,251 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 71,962,174 - 72,261,226 (+) NCBI Celera 18 66,780,263 - 67,073,707 (+) NCBI Celera Cytogenetic Map 18 q12.2 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dym Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dym (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of DYM mRNA CTD PMID:16214954 Dym Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DYM mRNA CTD PMID:33387578 and PMID:34747641 Dym Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dym (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DYM mRNA CTD PMID:21570461 Dym Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DYM mRNA CTD PMID:21215274 and PMID:32109520 Dym Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dym (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DYM mRNA CTD PMID:18796159 Dym Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Dym Rat aflatoxin B1 affects expression ISO DYM (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of DYM protein CTD PMID:20106945 Dym Rat aflatoxin B1 increases methylation ISO DYM (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DYM intron CTD PMID:30157460 Dym Rat aflatoxin B1 decreases expression ISO Dym (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of DYM mRNA CTD PMID:19770486 Dym Rat all-trans-retinoic acid decreases expression ISO DYM (Homo sapiens) 6480464 Tretinoin results in decreased expression of DYM mRNA CTD PMID:33167477 Dym Rat aristolochic acid A decreases expression ISO DYM (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DYM mRNA CTD PMID:33212167 Dym Rat arsane affects methylation ISO DYM (Homo sapiens) 6480464 Arsenic affects the methylation of DYM gene CTD PMID:25304211 Dym Rat arsenic atom affects methylation ISO DYM (Homo sapiens) 6480464 Arsenic affects the methylation of DYM gene CTD PMID:25304211 Dym Rat benzo[a]pyrene decreases expression ISO Dym (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DYM mRNA CTD PMID:19770486 and PMID:21715664 Dym Rat benzo[a]pyrene affects methylation ISO DYM (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DYM promoter CTD PMID:27901495 Dym Rat benzo[a]pyrene increases methylation ISO Dym (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of DYM intron CTD PMID:27901495 Dym Rat benzo[a]pyrene decreases expression ISO DYM (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DYM mRNA CTD PMID:20064835 more ... Dym Rat benzo[e]pyrene increases methylation ISO DYM (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of DYM intron CTD PMID:30157460 Dym Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of DYM mRNA CTD PMID:15651846 Dym Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DYM mRNA CTD PMID:25181051 Dym Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DYM gene CTD PMID:28505145 Dym Rat carbon nanotube increases expression ISO Dym (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of DYM mRNA CTD PMID:25554681 Dym Rat CGP 52608 multiple interactions ISO DYM (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DYM gene] CTD PMID:28238834 Dym Rat chlordecone decreases expression ISO Dym (Mus musculus) 6480464 Chlordecone results in decreased expression of DYM mRNA CTD PMID:29980752 Dym Rat choline multiple interactions ISO Dym (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DYM gene CTD PMID:20938992 Dym Rat cisplatin decreases expression ISO DYM (Homo sapiens) 6480464 Cisplatin results in decreased expression of DYM mRNA CTD PMID:19561079 Dym Rat cisplatin decreases expression ISO Dym (Mus musculus) 6480464 Cisplatin results in decreased expression of DYM mRNA CTD PMID:25270620 Dym Rat cyclosporin A increases expression ISO DYM (Homo sapiens) 6480464 Cyclosporine results in increased expression of DYM mRNA CTD PMID:20106945 more ... Dym Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of DYM gene CTD PMID:30207508 Dym Rat Dibutyl phosphate affects expression ISO DYM (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DYM mRNA CTD PMID:37042841 Dym Rat doxorubicin decreases expression ISO DYM (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DYM mRNA CTD PMID:29803840 Dym Rat elemental selenium decreases expression ISO DYM (Homo sapiens) 6480464 Selenium results in decreased expression of DYM mRNA CTD PMID:19244175 Dym Rat fenthion decreases expression ISO Dym (Mus musculus) 6480464 Fenthion results in decreased expression of DYM mRNA CTD PMID:34813904 Dym Rat folic acid multiple interactions ISO Dym (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DYM gene CTD PMID:20938992 Dym Rat formaldehyde decreases expression ISO DYM (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DYM mRNA CTD PMID:23649840 Dym Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DYM mRNA CTD PMID:22061828 Dym Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of DYM gene CTD PMID:31011160 Dym Rat hydroxyurea increases mutagenesis ISO Dym (Mus musculus) 6480464 Hydroxyurea results in increased mutagenesis of DYM gene CTD PMID:16868089 Dym Rat ivermectin decreases expression ISO DYM (Homo sapiens) 6480464 Ivermectin results in decreased expression of DYM protein CTD PMID:32959892 Dym Rat L-methionine multiple interactions ISO Dym (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DYM gene CTD PMID:20938992 Dym Rat methapyrilene increases methylation ISO DYM (Homo sapiens) 6480464 Methapyrilene results in increased methylation of DYM intron CTD PMID:30157460 Dym Rat methidathion decreases expression ISO Dym (Mus musculus) 6480464 methidathion results in decreased expression of DYM mRNA CTD PMID:34813904 Dym Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of DYM gene CTD PMID:35440735 Dym Rat N-methyl-N-nitrosourea increases mutagenesis ISO Dym (Mus musculus) 6480464 Methylnitrosourea results in increased mutagenesis of DYM gene CTD PMID:16868089 Dym Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DYM mRNA CTD PMID:25729387 Dym Rat ozone multiple interactions ISO DYM (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of DYM mRNA CTD PMID:35430440 Dym Rat paracetamol affects expression ISO Dym (Mus musculus) 6480464 Acetaminophen affects the expression of DYM mRNA CTD PMID:17562736 Dym Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DYM mRNA CTD PMID:33387578 Dym Rat paracetamol decreases expression ISO DYM (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DYM mRNA CTD PMID:21420995 Dym Rat pirinixic acid decreases expression ISO Dym (Mus musculus) 6480464 pirinixic acid results in decreased expression of DYM mRNA CTD PMID:20813756 Dym Rat selenium atom decreases expression ISO DYM (Homo sapiens) 6480464 Selenium results in decreased expression of DYM mRNA CTD PMID:19244175 Dym Rat sunitinib increases expression ISO DYM (Homo sapiens) 6480464 Sunitinib results in increased expression of DYM mRNA CTD PMID:31533062 Dym Rat thapsigargin decreases expression ISO Dym (Mus musculus) 6480464 Thapsigargin results in decreased expression of DYM protein CTD PMID:24648495 Dym Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DYM mRNA CTD PMID:34492290 Dym Rat titanium dioxide decreases methylation ISO Dym (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DYM gene CTD PMID:35295148 Dym Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DYM mRNA CTD PMID:25729387 Dym Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of DYM mRNA CTD PMID:30589522 Dym Rat triphenyl phosphate affects expression ISO DYM (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DYM mRNA CTD PMID:37042841 Dym Rat trovafloxacin decreases expression ISO Dym (Mus musculus) 6480464 trovafloxacin results in decreased expression of DYM mRNA CTD PMID:35537566 Dym Rat valproic acid increases expression ISO Dym (Mus musculus) 6480464 Valproic Acid results in increased expression of DYM mRNA CTD PMID:20546886 Dym Rat valproic acid affects expression ISO DYM (Homo sapiens) 6480464 Valproic Acid affects the expression of DYM mRNA CTD PMID:25979313 Dym Rat vancomycin increases expression ISO Dym (Mus musculus) 6480464 Vancomycin results in increased expression of DYM mRNA CTD PMID:18930951
Dym Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 70,879,835 - 71,176,006 (+) NCBI GRCr8 mRatBN7.2 18 68,605,131 - 68,900,905 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 68,605,185 - 68,900,903 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 70,718,041 - 71,013,638 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 71,386,410 - 71,683,811 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 69,244,060 - 69,539,675 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 70,996,074 - 71,313,033 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 70,996,044 - 71,313,084 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 70,178,416 - 70,449,688 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 71,889,053 - 72,188,251 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 71,962,174 - 72,261,226 (+) NCBI Celera 18 66,780,263 - 67,073,707 (+) NCBI Celera Cytogenetic Map 18 q12.2 NCBI
DYM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 49,036,387 - 49,460,645 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 49,036,387 - 49,461,347 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 46,562,757 - 46,987,015 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 44,824,170 - 45,241,077 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 44,824,169 - 45,241,077 NCBI Celera 18 43,423,709 - 43,842,456 (-) NCBI Celera Cytogenetic Map 18 q21.1 NCBI HuRef 18 43,422,918 - 43,840,755 (-) NCBI HuRef CHM1_1 18 46,565,142 - 46,982,392 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 49,231,816 - 49,658,383 (-) NCBI T2T-CHM13v2.0
Dym Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 75,151,772 - 75,420,037 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 75,151,852 - 75,420,035 (+) Ensembl GRCm39 Ensembl GRCm38 18 75,018,699 - 75,286,966 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 75,018,781 - 75,286,964 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 75,178,426 - 75,446,620 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 75,144,137 - 75,412,331 (+) NCBI MGSCv36 mm8 Celera 18 76,242,337 - 76,521,558 (+) NCBI Celera Cytogenetic Map 18 E3 NCBI cM Map 18 50.97 NCBI
Dym Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 34,150,783 - 34,542,507 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 34,150,783 - 34,541,944 (-) NCBI ChiLan1.0 ChiLan1.0
DYM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 66,578,224 - 66,989,529 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 52,268,524 - 52,682,132 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 42,427,493 - 42,842,450 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 45,780,831 - 46,179,616 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 45,783,379 - 46,162,835 (-) Ensembl panpan1.1 panPan2
DYM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 79,286,558 - 79,629,451 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 79,286,614 - 79,629,043 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 78,691,499 - 79,034,045 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 79,353,467 - 79,696,604 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 79,353,400 - 79,697,033 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 79,068,269 - 79,410,974 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 79,098,408 - 79,441,226 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 79,383,285 - 79,726,463 (+) NCBI UU_Cfam_GSD_1.0
Dym Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 38,237,505 - 38,575,582 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 13,476,326 - 13,818,059 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 13,476,376 - 13,816,515 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DYM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 98,638,339 - 99,024,642 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 98,642,506 - 99,024,664 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 108,216,906 - 108,352,210 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DYM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 31,513,665 - 31,902,064 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 31,513,735 - 31,901,811 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 5,734,433 - 6,137,618 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dym
.
Assembly: mRatBN7.2 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 282 Count of miRNA genes: 129 Interacting mature miRNAs: 137 Transcripts: ENSRNOT00000024950, ENSRNOT00000066336 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1331770 Bp234 Blood pressure QTL 234 3.807 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 71893566 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat
D18Rat83
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 70,906,674 - 70,906,819 (+) Marker Load Pipeline mRatBN7.2 18 68,631,562 - 68,631,709 (+) MAPPER mRatBN7.2 Rnor_6.0 18 71,028,936 - 71,029,080 NCBI Rnor6.0 Rnor_5.0 18 70,165,216 - 70,165,360 UniSTS Rnor5.0 RGSC_v3.4 18 71,916,282 - 71,916,427 RGD RGSC3.4 RGSC_v3.4 18 71,916,283 - 71,916,427 UniSTS RGSC3.4 RGSC_v3.1 18 71,989,396 - 71,989,686 RGD Celera 18 66,806,536 - 66,806,680 UniSTS SHRSP x BN Map 18 43.2499 UniSTS SHRSP x BN Map 18 43.2499 RGD Cytogenetic Map 18 q12.3 UniSTS
RH134522
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 68,900,668 - 68,900,857 (+) MAPPER mRatBN7.2 Rnor_6.0 18 71,312,797 - 71,312,985 NCBI Rnor6.0 Rnor_5.0 18 70,449,452 - 70,449,640 UniSTS Rnor5.0 RGSC_v3.4 18 72,188,015 - 72,188,203 UniSTS RGSC3.4 Celera 18 67,073,471 - 67,073,659 UniSTS RH 3.4 Map 18 710.5 UniSTS Cytogenetic Map 18 q12.3 UniSTS
RH143452
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 68,725,014 - 68,725,137 (+) MAPPER mRatBN7.2 Rnor_6.0 18 71,137,349 - 71,137,471 NCBI Rnor6.0 Rnor_5.0 18 70,273,614 - 70,273,736 UniSTS Rnor5.0 RGSC_v3.4 18 72,011,886 - 72,012,008 UniSTS RGSC3.4 Celera 18 66,897,029 - 66,897,151 UniSTS RH 3.4 Map 18 710.4 UniSTS Cytogenetic Map 18 q12.3 UniSTS
G47243
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 68,817,139 - 68,817,391 (+) MAPPER mRatBN7.2 Rnor_6.0 18 71,229,437 - 71,229,686 NCBI Rnor6.0 Rnor_5.0 18 70,365,890 - 70,366,139 UniSTS Rnor5.0 RGSC_v3.4 18 72,104,065 - 72,104,314 UniSTS RGSC3.4 Celera 18 66,989,187 - 66,989,436 UniSTS Cytogenetic Map 18 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024950 ⟹ ENSRNOP00000024950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 68,605,226 - 68,900,898 (+) Ensembl Rnor_6.0 Ensembl 18 70,996,044 - 71,313,084 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000066336 ⟹ ENSRNOP00000060744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 68,605,202 - 68,900,903 (+) Ensembl Rnor_6.0 Ensembl 18 70,996,140 - 71,313,031 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110740 ⟹ ENSRNOP00000081467
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 68,605,185 - 68,900,863 (+) Ensembl
RefSeq Acc Id:
NM_001106133 ⟹ NP_001099603
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,880,332 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,202 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,140 - 71,313,033 (+) NCBI Rnor_5.0 18 70,178,416 - 70,449,688 (+) NCBI RGSC_v3.4 18 71,889,053 - 72,188,251 (+) RGD Celera 18 66,780,263 - 67,073,707 (+) RGD
Sequence:
CTTCCCTCTTCTCACTTCAGCTCTTGCGTCTCCGCACCGACAGCCGCTGGGGCCGCTGGGGCCGCCGGAGCGCGGTCGGAGCAGGAGCCGCTGAGCTACGGAACCATGGAGGCCTAAGCCAGCGTGCA
hide sequence
RefSeq Acc Id:
XM_008772103 ⟹ XP_008770325
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,138 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,076 - 71,313,033 (+) NCBI
Sequence:
GCCACGGGACCGCCCGCTGCTGGCGCGCGCTTAGCCGTTCGGTCCCCAGCCGCGTCCTCCGTCGCTTCCCTCTTCTCACTTCAGCTCTTGCGTCTCCGCACCGACAGCCGCTGGGGCCGCTGGGGCCG
hide sequence
RefSeq Acc Id:
XM_017600877 ⟹ XP_017456366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,134 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,074 - 71,313,033 (+) NCBI
Sequence:
GTGCCACGGGACCGCCCGCTGCTGGCGCGCGCTTAGCCGTTCGGTCCCCAGCCGCGTCCTCCGT
hide sequence
RefSeq Acc Id:
XM_017600878 ⟹ XP_017456367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,880,624 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,481 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,382 - 71,313,033 (+) NCBI
Sequence:
GCGGGGTGTGAGCCGGGGCGACCGGCCGCGCGCCGGAGGGCTGCGGTTCGGGAAGGTTGGGCCGCCCGGAGCGGTGCAGAGATCGGCGGGCCTCTTCTGCCCGCCCCCTCGGCGCCCGGGTGTGCAGA
hide sequence
RefSeq Acc Id:
XM_017600879 ⟹ XP_017456368
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,135 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,075 - 71,313,033 (+) NCBI
Sequence:
TGCCACGGGACCGCCCGCTGCTGGCGCGCGCTTAGCCGTTCGGTCCCCAGCCGCGTCCTCCGTC
hide sequence
RefSeq Acc Id:
XM_017600880 ⟹ XP_017456369
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,136 - 68,900,905 (+) NCBI Rnor_6.0 18 70,996,075 - 71,313,033 (+) NCBI
Sequence:
TGCCACGGGACCGCCCGCTGCTGGCGCGCGCTTAGCCGTTCGGTCCCCAGCCGCGTCCTCCGTCGCTTCCCTCTTCTCACTTCAGCTCTTGCGTCTCCGCACCGACAGCCGCTGGGGCCGCTGGGGCC
hide sequence
RefSeq Acc Id:
XM_039096637 ⟹ XP_038952565
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,131 - 68,900,905 (+) NCBI
RefSeq Acc Id:
XM_039096638 ⟹ XP_038952566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI mRatBN7.2 18 68,605,135 - 68,900,905 (+) NCBI
RefSeq Acc Id:
XM_063277161 ⟹ XP_063133231
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI
RefSeq Acc Id:
XM_063277162 ⟹ XP_063133232
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI
RefSeq Acc Id:
XM_063277164 ⟹ XP_063133234
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI
RefSeq Acc Id:
XM_063277165 ⟹ XP_063133235
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI
RefSeq Acc Id:
XM_063277166 ⟹ XP_063133236
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 70,879,835 - 71,176,006 (+) NCBI
RefSeq Acc Id:
NP_001099603 ⟸ NM_001106133
- UniProtKB:
D3ZP27 (UniProtKB/TrEMBL), A6KRI1 (UniProtKB/TrEMBL)
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSLVENNPRTGNLAALTKVFLARTRELRLSAECQNHIFIWQTHNALFIICCLLKVFICEMSEEELQL
hide sequence
RefSeq Acc Id:
XP_008770325 ⟸ XM_008772103
- Peptide Label:
isoform X5
- UniProtKB:
A0A0H2UHP8 (UniProtKB/TrEMBL), A6KRI0 (UniProtKB/TrEMBL), A6KRI1 (UniProtKB/TrEMBL)
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSL
hide sequence
RefSeq Acc Id:
XP_017456366 ⟸ XM_017600877
- Peptide Label:
isoform X1
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSLVENNPRTGNLAALTKVFLARTRELRLSAECQNHIFIWQTHNALFIICCLLKVFICEMSEEELQL
hide sequence
RefSeq Acc Id:
XP_017456369 ⟸ XM_017600880
- Peptide Label:
isoform X3
- UniProtKB:
B4F766 (UniProtKB/Swiss-Prot), A6KRI1 (UniProtKB/TrEMBL)
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSLVENNPRTGNLAALTKVFLARTRELRLSAECQNHIFIWQTHNALFIICCLLKVFICEMSEEELQL
hide sequence
RefSeq Acc Id:
XP_017456368 ⟸ XM_017600879
- Peptide Label:
isoform X2
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSL
hide sequence
RefSeq Acc Id:
XP_017456367 ⟸ XM_017600878
- Peptide Label:
isoform X1
- Sequence:
MGSNSSKISDLPKNEYLKRLSGPEAISENDPFWNQLFSFSFSAPTSSTELKLLEEATISVCKSL
hide sequence
Ensembl Acc Id:
ENSRNOP00000060744 ⟸ ENSRNOT00000066336
Ensembl Acc Id:
ENSRNOP00000024950 ⟸ ENSRNOT00000024950
RefSeq Acc Id:
XP_038952565 ⟸ XM_039096637
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038952566 ⟸ XM_039096638
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6G5Z6 (UniProtKB/TrEMBL), A6KRI1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000081467 ⟸ ENSRNOT00000110740
RefSeq Acc Id:
XP_063133231 ⟸ XM_063277161
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063133235 ⟸ XM_063277165
- Peptide Label:
isoform X5
- UniProtKB:
A0A0H2UHP8 (UniProtKB/TrEMBL), A6KRI0 (UniProtKB/TrEMBL), A6KRI1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133232 ⟸ XM_063277162
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063133234 ⟸ XM_063277164
- Peptide Label:
isoform X5
- UniProtKB:
A0A0H2UHP8 (UniProtKB/TrEMBL), A6KRI0 (UniProtKB/TrEMBL), A6KRI1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133236 ⟸ XM_063277166
- Peptide Label:
isoform X6
- UniProtKB:
A6KRI1 (UniProtKB/TrEMBL)
RGD ID: 13700871 Promoter ID: EPDNEW_R11393 Type: initiation region Name: Dym_1 Description: dymeclin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 70,996,132 - 70,996,192 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Dym
dymeclin
Dym_predicted
dymeclin (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Dym_predicted
dymeclin (predicted)
RGD1309111_predicted
similar to RIKEN cDNA 4933427L07 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1309111_predicted
similar to RIKEN cDNA 4933427L07 (predicted)
LOC291433_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC291433_predicted
similar to RIKEN cDNA 4933427L07 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
