Fscn2 (fascin actin-bundling protein 2, retinal) - Rat Genome Database

Fscn2 (fascin actin-bundling protein 2, retinal) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Fscn2 (fascin actin-bundling protein 2, retinal) Rattus norvegicus

Subscribe to Updates

Symbol:

Fscn2

Name:

fascin actin-bundling protein 2, retinal

RGD ID:

1308941

Description:

Predicted to enable actin filament binding activity. Predicted to be involved in actin filament bundle assembly; cell migration; and establishment or maintenance of cell polarity. Predicted to act upstream of or within eye photoreceptor cell development. Predicted to be located in stereocilium. Predicted to be active in actin cytoskeleton and cytoplasm. Human ortholog(s) of this gene implicated in retinitis pigmentosa and retinitis pigmentosa 30. Orthologous to human FSCN2 (fascin actin-bundling protein 2, retinal); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

Previously known as:

fascin homolog 2, actin-bundling protein, retinal; fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus); fascin-2; LOC303741

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,121,038 - 106,139,683 (+)	NCBI		GRCr8
mRatBN7.2	10	105,634,783 - 105,641,322 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,634,783 - 105,641,322 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	110,739,192 - 110,745,719 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	110,202,211 - 110,208,738 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,555,265 - 105,561,804 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,528,307 - 109,540,675 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,533,487 - 109,540,026 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,128,055 - 109,134,594 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	109,789,092 - 109,795,631 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	109,803,763 - 109,810,072 (+)	NCBI
Celera	10	104,180,130 - 104,186,669 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	retinitis pigmentosa		ISO	FSCN2 (Homo sapiens)	1598962		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	fundus dystrophy		ISO	FSCN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinal dystrophy	ClinVar	PMID:11527955 more ...
Fscn2	Rat	Leber congenital amaurosis		ISO	FSCN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leber congenital amaurosis	ClinVar	PMID:11527955 more ...
Fscn2	Rat	macular degeneration		ISO	FSCN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Macular degeneration	ClinVar	PMID:11527955 more ...
Fscn2	Rat	Meniere's disease		ISO	FSCN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Meniere disease	ClinVar	PMID:28492532
Fscn2	Rat	retinitis pigmentosa 30		ISO	FSCN2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:11527955 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	retinitis pigmentosa 30		ISO	FSCN2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	auditory system disease		ISS	Fscn2 (Mus musculus)	13592920		MouseDO
Fscn2	Rat	retinal degeneration		ISS	Fscn2 (Mus musculus)	13592920		MouseDO
Fscn2	Rat	retinitis pigmentosa 30		ISS	Fscn2 (Mus musculus)	13592920	OMIM:607921	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	retinitis pigmentosa 30		ISO	FSCN2 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	(+)-catechin	multiple interactions	ISO	FSCN2 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of FSCN2 mRNA	CTD	PMID:24763279
Fscn2	Rat	17beta-estradiol	multiple interactions	ISO	FSCN2 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of FSCN2 mRNA	CTD	PMID:20823114
Fscn2	Rat	2,2',5,5'-tetrachlorobiphenyl	increases expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Fscn2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	FSCN2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of FSCN2 mRNA	CTD	PMID:22574217
Fscn2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FSCN2 mRNA	CTD	PMID:27913140 and PMID:33387578
Fscn2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Fscn2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of FSCN2 mRNA	CTD	PMID:27913140
Fscn2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	FSCN2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of FSCN2 mRNA	CTD	PMID:27913140
Fscn2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of FSCN2 mRNA	CTD	PMID:24780913
Fscn2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FSCN2 mRNA	CTD	PMID:25825206
Fscn2	Rat	benzo[a]pyrene	decreases methylation	ISO	FSCN2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of FSCN2 promoter	CTD	PMID:27901495
Fscn2	Rat	benzo[a]pyrene	affects methylation	ISO	FSCN2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of FSCN2 exon	CTD	PMID:27901495
Fscn2	Rat	bis(2-ethylhexyl) phthalate	decreases methylation	ISO	Fscn2 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased methylation of FSCN2 gene	CTD	PMID:34319233
Fscn2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FSCN2 mRNA	CTD	PMID:25181051
Fscn2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FSCN2 mRNA	CTD	PMID:34947998
Fscn2	Rat	bisphenol A	increases methylation	ISO	Fscn2 (Mus musculus)	6480464	bisphenol A results in increased methylation of FSCN2 promoter	CTD	PMID:27312807
Fscn2	Rat	bucladesine	multiple interactions	ISO	FSCN2 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of FSCN2 mRNA	CTD	PMID:20823114
Fscn2	Rat	chlorpyrifos	multiple interactions	EXP		6480464	[Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of FSCN2 mRNA	CTD	PMID:27905518
Fscn2	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of FSCN2 mRNA	CTD	PMID:27905518
Fscn2	Rat	cisplatin	decreases expression	ISO	FSCN2 (Homo sapiens)	6480464	Cisplatin results in decreased expression of FSCN2 mRNA	CTD	PMID:27392435
Fscn2	Rat	cisplatin	affects response to substance	EXP		6480464	FSCN2 protein affects the susceptibility to Cisplatin	CTD	PMID:27989596
Fscn2	Rat	cisplatin	multiple interactions	EXP		6480464	[CTNNA1 protein affects the susceptibility to Cisplatin] which results in decreased expression of FSCN2 protein more ...	CTD	PMID:27989596
Fscn2	Rat	cisplatin	multiple interactions	ISO	FSCN2 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of FSCN2 mRNA	CTD	PMID:27392435
Fscn2	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of FSCN2 mRNA	CTD	PMID:23640034
Fscn2	Rat	dichloroacetic acid	increases expression	ISO	Fscn2 (Mus musculus)	6480464	Dichloroacetic Acid results in increased expression of FSCN2 mRNA	CTD	PMID:28962523
Fscn2	Rat	dioxygen	increases expression	ISO	FSCN2 (Homo sapiens)	6480464	Oxygen deficiency results in increased expression of FSCN2 mRNA	CTD	PMID:26516004
Fscn2	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of FSCN2 mRNA	CTD	PMID:29391264
Fscn2	Rat	Ethylenethiourea	decreases expression	EXP		6480464	Ethylenethiourea results in decreased expression of FSCN2 mRNA	CTD	PMID:27905518
Fscn2	Rat	Ethylenethiourea	multiple interactions	EXP		6480464	[Chlorpyrifos co-treated with Ethylenethiourea] results in decreased expression of FSCN2 mRNA	CTD	PMID:27905518
Fscn2	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of FSCN2 mRNA	CTD	PMID:30307764
Fscn2	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of FSCN2 mRNA	CTD	PMID:24395379
Fscn2	Rat	latrunculin A	multiple interactions	EXP		6480464	latrunculin A affects the reaction [FSCN2 protein inhibits the reaction [CTNNA1 protein affects the susceptibility to Cisplatin]]	CTD	PMID:27989596
Fscn2	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of FSCN2 mRNA	CTD	PMID:28801915
Fscn2	Rat	medroxyprogesterone acetate	multiple interactions	ISO	FSCN2 (Homo sapiens)	6480464	[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of FSCN2 mRNA	CTD	PMID:20823114
Fscn2	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of FSCN2 mRNA	CTD	PMID:28801915
Fscn2	Rat	PCB138	decreases expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Fscn2	Rat	sunitinib	increases expression	ISO	FSCN2 (Homo sapiens)	6480464	Sunitinib results in increased expression of FSCN2 mRNA	CTD	PMID:31533062
Fscn2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of FSCN2 mRNA	CTD	PMID:34492290
Fscn2	Rat	titanium dioxide	decreases expression	ISO	Fscn2 (Mus musculus)	6480464	titanium dioxide results in decreased expression of FSCN2 mRNA	CTD	PMID:29264374
Fscn2	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FSCN2 mRNA	CTD	PMID:33387578
Fscn2	Rat	triphenyl phosphate	affects expression	ISO	FSCN2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of FSCN2 mRNA	CTD	PMID:37042841
Fscn2	Rat	triptonide	increases expression	ISO	Fscn2 (Mus musculus)	6480464	triptonide results in increased expression of FSCN2 mRNA	CTD	PMID:33045310
Fscn2	Rat	valproic acid	increases methylation	ISO	FSCN2 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of FSCN2 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	actin filament bundle assembly	involved_in	IBA	FB:FBgn0003447 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	actin filament organization	involved_in	IEA	InterPro:IPR010431	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fscn2	Rat	biological_process		ND		1598407	1/2007: no relevant rat data	RGD
Fscn2	Rat	cell migration	involved_in	IBA	FB:FBgn0003447 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	establishment or maintenance of cell polarity	involved_in	IBA	FB:FBgn0003447 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	eye photoreceptor cell development	acts_upstream_of_or_within	ISO	Fscn2 (Mus musculus)	1624291	MGI:3612338 PMID:16043865	RGD	PMID:16043865
Fscn2	Rat	eye photoreceptor cell development	acts_upstream_of_or_within	IEA	UniProtKB:Q32M02 and ensembl:ENSMUSP00000026445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	actin cytoskeleton	located_in	ISO	Fscn2 (Mus musculus)	1624291	PMID:20660251	RGD	PMID:20660251
Fscn2	Rat	actin cytoskeleton	located_in	IEA	UniProtKB:Q32M02 and ensembl:ENSMUSP00000026445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fscn2	Rat	actin cytoskeleton	is_active_in	IBA	FB:FBgn0003447 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0003447 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fscn2	Rat	cytoskeleton	located_in	IEA	UniProtKB-SubCell:SL-0090	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fscn2	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fscn2	Rat	stereocilium	located_in	ISO	Fscn2 (Mus musculus)	1624291	PMID:20660251	RGD	PMID:20660251
Fscn2	Rat	stereocilium	located_in	IEA	UniProtKB:Q32M02 and ensembl:ENSMUSP00000026445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fscn2	Rat	actin binding	enables	IEA	UniProtKB-KW:KW-0009	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fscn2	Rat	actin filament binding	enables	IEA	InterPro:IPR010431 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fscn2	Rat	actin filament binding	enables	IBA	MGI:1352745 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fscn2	Rat	protein binding		IPI	Hcn2 (Rattus norvegicus)	9686140		RGD
Fscn2	Rat	protein binding	enables	ISO	FSCN2 (Homo sapiens)	1624291	UniProtKB:P17252 more ...	RGD	PMID:32814053
Fscn2	Rat	protein-macromolecule adaptor activity	enables	IEA	InterPro:IPR022768 and InterPro:IPR024703	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	HCN1 and HCN2 proteins are expressed in cochlear hair cells: HCN1 can form a ternary complex with protocadherin 15 CD3 and F-actin-binding filamin A or can interact with HCN2.	Ramakrishnan NA, etal., J Biol Chem. 2012 Nov 2;287(45):37628-46. doi: 10.1074/jbc.M112.375832. Epub 2012 Sep 4.
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.	Wada Y, etal., Invest Ophthalmol Vis Sci. 2001 Sep;42(10):2395-400.

PMID:16043865	PMID:20660251	PMID:27989596

Fscn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	106,121,038 - 106,139,683 (+)	NCBI		GRCr8
mRatBN7.2	10	105,634,783 - 105,641,322 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,634,783 - 105,641,322 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	110,739,192 - 110,745,719 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	110,202,211 - 110,208,738 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,555,265 - 105,561,804 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,528,307 - 109,540,675 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,533,487 - 109,540,026 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	109,128,055 - 109,134,594 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	109,789,092 - 109,795,631 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	109,803,763 - 109,810,072 (+)	NCBI
Celera	10	104,180,130 - 104,186,669 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

FSCN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	81,515,062 - 81,537,130 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	81,528,377 - 81,537,130 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	79,495,403 - 79,504,156 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	77,110,012 - 77,114,632 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	77,110,016 - 77,114,631	NCBI
Celera	17	76,139,079 - 76,148,244 (+)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	74,944,167 - 74,951,874 (+)	NCBI		HuRef
CHM1_1	17	79,581,654 - 79,590,360 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	82,430,273 - 82,454,442 (+)	NCBI		T2T-CHM13v2.0

Fscn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	120,250,991 - 120,258,999 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	120,252,360 - 120,258,994 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	120,360,165 - 120,368,173 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	120,361,534 - 120,368,168 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	120,222,848 - 120,229,487 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	120,177,624 - 120,184,261 (+)	NCBI		MGSCv36	mm8
Celera	11	132,096,284 - 132,102,924 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	84.08	NCBI

Fscn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	1,526,830 - 1,533,775 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	1,526,830 - 1,533,775 (-)	NCBI	ChiLan1.0	ChiLan1.0

FSCN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	98,111,412 - 98,126,571 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	103,013,967 - 103,024,231 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	75,974,971 - 75,993,275 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	81,687,051 - 81,694,823 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	81,687,051 - 81,694,823 (+)	Ensembl	panpan1.1		panPan2

FSCN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	616,088 - 622,152 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	617,609 - 621,882 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	1,218,766 - 1,224,987 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	1,210,196 - 1,216,414 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	1,211,869 - 1,216,141 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	1,234,897 - 1,241,112 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	1,360,741 - 1,366,958 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	1,440,630 - 1,446,849 (-)	NCBI		UU_Cfam_GSD_1.0

Fscn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	1,216,619 - 1,227,828 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	5,184,628 - 5,191,985 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	5,184,133 - 5,195,340 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FSCN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	1,300,055 - 1,309,778 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	1,300,286 - 1,311,562 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	1,143,345 - 1,156,961 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FSCN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	73,472,582 - 73,482,440 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	73,474,519 - 73,481,967 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	44,854,818 - 44,864,455 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fscn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	10,511,673 - 10,517,753 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	10,511,539 - 10,518,073 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Fscn2
24 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	86
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000054975
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat

RH134306

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	106,139,278 - 106,139,552 (+)	Marker Load Pipeline
mRatBN7.2	10	105,640,917 - 105,641,191 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	109,539,622 - 109,539,895	NCBI	Rnor6.0
Rnor_5.0	10	109,134,190 - 109,134,463	UniSTS	Rnor5.0
RGSC_v3.4	10	109,795,227 - 109,795,500	UniSTS	RGSC3.4
Celera	10	104,186,265 - 104,186,538	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH138456

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	105,638,822 - 105,638,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	109,537,527 - 109,537,668	NCBI	Rnor6.0
Rnor_5.0	10	109,132,095 - 109,132,236	UniSTS	Rnor5.0
RGSC_v3.4	10	109,793,132 - 109,793,273	UniSTS	RGSC3.4
Celera	10	104,184,170 - 104,184,311	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	109	70	69	38	25	38	6	197	97	89	45	59	31


RefSeq Transcripts	NM_001107072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000054975 ⟹ ENSRNOP00000051858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	105,634,783 - 105,641,322 (+)	Ensembl
Rnor_6.0 Ensembl	10	109,533,487 - 109,540,026 (+)	Ensembl

RefSeq Acc Id:

NM_001107072 ⟹ NP_001100542

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,133,144 - 106,139,683 (+)	NCBI
mRatBN7.2	10	105,634,783 - 105,641,322 (+)	NCBI
Rnor_6.0	10	109,533,487 - 109,540,026 (+)	NCBI
Rnor_5.0	10	109,128,055 - 109,134,594 (+)	NCBI
RGSC_v3.4	10	109,789,092 - 109,795,631 (+)	RGD
Celera	10	104,180,130 - 104,186,669 (+)	RGD

Sequence:

show sequence

CACAAGACAGAGGGAGCTGACTCTGAGGCAGGGAGTGTCCATGTTGCTGGCTAGGCTTGGGAGCCAAGGGCCAGATAAACAGATCTGGGCCTCAGGGGGGGCTACAGGCCCCCTGAACACTCAGAGAG
AGCTCCCTGGACCCCTGAAGCAACTTGGCTAGTCTCAAAGATGCCAACCAACGGCTTGCACCAGGTGCTGAAGATCCAGTTTGGCCTTGTGAACGATGCCGACCGCTACCTCACGGCTGAGAGCTTTG
GCTTCAAGGTCAACGCTTCCGCAGCCAGCCTCAAGAGGAAGCAGATATGGGTCCTGGAGCCTGACCCAGGGCAGGGCACTGCTGTGCTGTTTCGCAGCAGCCACCTAGGCCGCTACCTGTCGGCAGAA
GAAGATGGGCGCGTGGCCTGTGAGATGGATCACCCGGGCCGTGACTGTCGCTTCTTGGTCTTGCCGCAGCCTGACGGGCGCTGGGTGCTGCAGTCAGAGCCACACGGCCGCTTCTTTGGTGGCGTTGA
GGACCGACTGTCCTGCTTTGCTACGGCCATCTCCCCGGCAGAGCTGTGGACCGTACACCTGGCCATCCACCCACAGGCTCACTTGCTGAGTGTGAGCCGCCGGCGCTACGTGCACCTGTGCCTTCAGG
AGGACGAGATGGCGGCAGATGGTGACATGCCGTGGGGTGTGGACGCACTGCTCACCCTCATTTTCCAGAGCAGGCGGTACTGCCTCAAGTCTTATGACAGCCGCTACCTTCGAAGTGATGGCCGCCTT
GTCTGGGAGCCTGAAGCCCATGCCTGCTACACACTGGAGTTCAAGGCAGGCAAGCTGGCCTTCAAGGACTGTGACGGCCGATACCTGGCACCTGTGGGGCCTGCCGGCACGCTTAAGGCTGGCCGAAA
CACGAGGCCCGGCAAGGATGAACTCTTCGACCTGGAGCAGAGTCACCCACAGGTGGTACTGGTAGCTGCCAACCACCGCTACGTCTCTGTGAGGCAAGGAATCAATGTCTCAGCCAATCAGGATGAAG
AACTGGACCATGAGACATTCCTAATGCAAATCGACCAGGAGACAAAGAAGTGTACTTTCTATTCCAGCACTGGGGGCTACTGGACCTTGGTCACTCACGGGGGCATTCAGGCCACAGCCACGCAAGTT
TCTGCCAACACCATGTTTGAAATAGAATGGCACGGCCGGCGGGTGGCACTTAAAGCCAGCAATGGGCGTTATGTGTGCATGAAGAAGAATGGGCAGCTGGCTGCTATCAGTGACTTTGTGGGTGAGGA
CGAGTTATTCATCCTCAAACTCATCAACCGACCCATCCTGGTGCTCCGTGGCCTGGATGGCTTTGTGTGCCACCGCCGAGGCTCCAACCAGCTGGACACCAACCGCTCCACCTACGATGTCTTCCACC
TGAGCTTCAGGGATGGCGCCTATCAAATCAGAGGCCGTGGAGGTGGGTTCTGGTACACTGGGAGCCATGGAAGTGTGTGCAGCGATGGTGACTTGGCGGAGGATTTCCTCTTCGAGTTCCGAGAGCGT
GGCCGTTTGGCCATCCGTGCCCTCAGTGGCAAGTACCTGCGTGGAGGTGCCTCAGGGCTGCTGCGTGCTGACGCGGACCTGCCTACGGGGGAAGCTCTCTGGGAATATTGAGGACTCACAGGGGGTCA
ACCCCAGAGCCAACCTACCCAGCATTAAACCTTTGTTGCAGAGTTG

hide sequence

RefSeq Acc Id:

XM_063269251 ⟹ XP_063125321

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,121,184 - 106,139,682 (+)	NCBI

RefSeq Acc Id:

XM_063269252 ⟹ XP_063125322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,121,038 - 106,139,682 (+)	NCBI

RefSeq Acc Id:

XM_063269253 ⟹ XP_063125323

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	106,133,312 - 106,139,682 (+)	NCBI


Protein RefSeqs	NP_001100542	(Get FASTA)	NCBI Sequence Viewer
	XP_063125321	(Get FASTA)	NCBI Sequence Viewer
	XP_063125322	(Get FASTA)	NCBI Sequence Viewer
	XP_063125323	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06828	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051858
	ENSRNOP00000051858.2

RefSeq Acc Id:

NP_001100542 ⟸ NM_001107072

- UniProtKB:

D3ZX02 (UniProtKB/TrEMBL), A6HLC3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPTNGLHQVLKIQFGLVNDADRYLTAESFGFKVNASAASLKRKQIWVLEPDPGQGTAVLFRSSHLGRYLSAEEDGRVACEMDHPGRDCRFLVLPQPDGRWVLQSEPHGRFFGGVEDRLSCFATAISPA
ELWTVHLAIHPQAHLLSVSRRRYVHLCLQEDEMAADGDMPWGVDALLTLIFQSRRYCLKSYDSRYLRSDGRLVWEPEAHACYTLEFKAGKLAFKDCDGRYLAPVGPAGTLKAGRNTRPGKDELFDLEQ
SHPQVVLVAANHRYVSVRQGINVSANQDEELDHETFLMQIDQETKKCTFYSSTGGYWTLVTHGGIQATATQVSANTMFEIEWHGRRVALKASNGRYVCMKKNGQLAAISDFVGEDELFILKLINRPIL
VLRGLDGFVCHRRGSNQLDTNRSTYDVFHLSFRDGAYQIRGRGGGFWYTGSHGSVCSDGDLAEDFLFEFRERGRLAIRALSGKYLRGGASGLLRADADLPTGEALWEY

hide sequence

Ensembl Acc Id:

ENSRNOP00000051858 ⟸ ENSRNOT00000054975

RefSeq Acc Id:	XP_063125322 ⟸ XM_063269252
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063125321 ⟸ XM_063269251
- Peptide Label:	isoform X1
- UniProtKB:	A6HLC3 (UniProtKB/TrEMBL), D3ZX02 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063125323 ⟸ XM_063269253
- Peptide Label:	isoform X3

Protein Domains

Fascin

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZX02-F1-model_v2	AlphaFold	D3ZX02	1-492	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22437	BioCyc
Ensembl Genes	ENSRNOG00000036700	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000054975	ENTREZGENE
	ENSRNOT00000054975.3	UniProtKB/TrEMBL
Gene3D-CATH	2.80.10.50	UniProtKB/TrEMBL
InterPro	Actin_cross-linking	UniProtKB/TrEMBL
	Fascin	UniProtKB/TrEMBL
	Fascin	UniProtKB/TrEMBL
	Fascin-domain	UniProtKB/TrEMBL
KEGG Report	rno:303741	UniProtKB/TrEMBL
NCBI Gene	303741	ENTREZGENE
PANTHER	FASCIN-2	UniProtKB/TrEMBL
	PTHR10551	UniProtKB/TrEMBL
Pfam	Fascin	UniProtKB/TrEMBL
PhenoGen	Fscn2	PhenoGen
PIRSF	Fascin	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000036700	RatGTEx
Superfamily-SCOP	Actin_crosslink	UniProtKB/TrEMBL
UniProt	A6HLC3	ENTREZGENE, UniProtKB/TrEMBL
	D3ZX02	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-02-13	Fscn2	fascin actin-bundling protein 2, retinal	Fscn2	fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Fscn2	fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus)	Fscn2_predicted	fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Fscn2_predicted	fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus) (predicted)			Symbol and Name status set to approved	70820	APPROVED