Advanced Search (OLGA)

Gene: Rab18 (RAB18, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab18

Name:

RAB18, member RAS oncogene family

RGD ID:

1308905

Description:

Predicted to enable G protein activity and GDP binding activity. Predicted to be involved in several processes, including endoplasmic reticulum tubular network organization; import into nucleus; and lipid droplet organization. Is active in synapse. Human ortholog(s) of this gene implicated in Warburg micro syndrome 3. Orthologous to human RAB18 (RAB18, member RAS oncogene family); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC307039; MGC109292; ras-related protein Rab-18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB18 (RAB18, member RAS oncogene family)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rab18 (RAB18, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAB18 (RAB18, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab18 (RAB18, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab18b (RAB18B, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab18a (RAB18A, member RAS oncogene family)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rab-18	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab18	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab18	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab18	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab18	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	59,639,264 - 59,670,653 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	59,639,203 - 59,672,806 (+)	Ensembl				GRCr8
mRatBN7.2	17	54,944,099 - 54,976,093 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	54,943,955 - 54,976,043 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	58,113,041 - 58,144,409 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	62,116,142 - 62,147,501 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	56,282,675 - 56,314,053 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	17	60,941,308 - 60,972,757 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	17	60,374,917 - 60,406,372 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	17	57,953,905 - 57,985,281 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	17	59,034,611 - 59,065,963 (+)	NCBI		F344_StmMcwi
Rnor_6.0	17	59,844,781 - 59,876,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	59,844,781 - 59,876,164 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	61,632,659 - 61,664,794 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	63,497,924 - 63,529,233 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	56,284,171 - 56,315,512 (+)	NCBI		Celera
RGSC_v3.1	17	63,508,756 - 63,540,065 (+)	NCBI
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Warburg micro syndrome (ISO)

Warburg micro syndrome 3 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

amphetamine (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (EXP)

CGP 52608 (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

eugenol (EXP)

flutamide (EXP)

FR900359 (ISO)

genistein (ISO)

gold atom (ISO)

gold(0) (ISO)

GSK-J4 (ISO)

hexadecanoic acid (ISO)

hypochlorous acid (ISO)

indometacin (ISO)

ivermectin (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

mitomycin C (ISO)

oleic acid (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

propiconazole (EXP)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brain development (ISS)

endoplasmic reticulum tubular network organization (ISO)

eye development (ISS)

import into nucleus (ISO)

intracellular protein transport (IBA)

lipid droplet organization (IBA,ISO)

protein transport (IEA)

Cellular Component

apical plasma membrane (IEA)

cis-Golgi network membrane (ISO,ISS)

endomembrane system (IBA)

endoplasmic reticulum membrane (IEA,ISO,ISS)

endoplasmic reticulum tubular network (ISO)

Golgi apparatus (IBA,IEA)

lipid droplet (IEA,ISO,ISS)

synapse (EXP,IDA)

Molecular Function

G protein activity (IEA,ISO,ISS)

GDP binding (ISO,ISS)

GTP binding (IEA)

GTPase activity (IBA,IEA,ISO,ISS)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.

Additional References at PubMed

PMID:15489334	PMID:17488286	PMID:20937701	PMID:21112318	PMID:23333653	PMID:23376485	PMID:24239381	PMID:24625528	PMID:24891604	PMID:26021350	PMID:30721447	PMID:30970241

Genomics

Comparative Map Data

Rab18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	59,639,264 - 59,670,653 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	59,639,203 - 59,672,806 (+)	Ensembl				GRCr8
mRatBN7.2	17	54,944,099 - 54,976,093 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	54,943,955 - 54,976,043 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	58,113,041 - 58,144,409 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	62,116,142 - 62,147,501 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	56,282,675 - 56,314,053 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	17	60,941,308 - 60,972,757 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	17	60,374,917 - 60,406,372 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	17	57,953,905 - 57,985,281 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	17	59,034,611 - 59,065,963 (+)	NCBI		F344_StmMcwi
Rnor_6.0	17	59,844,781 - 59,876,170 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	59,844,781 - 59,876,164 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	61,632,659 - 61,664,794 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	63,497,924 - 63,529,233 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	56,284,171 - 56,315,512 (+)	NCBI		Celera
RGSC_v3.1	17	63,508,756 - 63,540,065 (+)	NCBI
Cytogenetic Map	17	q12.1	NCBI

RAB18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	27,504,304 - 27,542,239 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	27,504,174 - 27,545,117 (+)	Ensembl			hg38	GRCh38
GRCh37	10	27,793,233 - 27,831,168 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	27,833,255 - 27,869,105 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	27,833,254 - 27,869,103	NCBI
Celera	10	27,556,861 - 27,592,716 (+)	NCBI		Celera
Cytogenetic Map	10	p12.1	NCBI
HuRef	10	27,509,631 - 27,547,699 (+)	NCBI		HuRef
CHM1_1	10	27,792,934 - 27,831,114 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	27,534,698 - 27,572,633 (+)	NCBI		T2T-CHM13v2.0

Rab18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	6,765,167 - 6,791,606 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	6,733,905 - 6,794,429 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	6,765,167 - 6,791,606 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	6,733,905 - 6,794,429 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	6,765,203 - 6,790,229 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	6,765,203 - 6,790,229 (+)	NCBI		MGSCv36	mm8
Celera	18	6,810,932 - 6,835,956 (+)	NCBI		Celera
Cytogenetic Map	18	A1	NCBI
cM Map	18	4.53	NCBI

Rab18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	1,380,156 - 1,411,804 (+)	Ensembl
ChiLan1.0	NW_004955462	1,380,158 - 1,411,804 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAB18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	40,160,001 - 40,195,980 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	40,165,327 - 40,202,269 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	27,639,726 - 27,676,555 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	28,001,249 - 28,037,527 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	28,001,249 - 28,037,527 (+)	Ensembl			panPan2	panpan1.1

RAB18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	6,071,944 - 6,112,064 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	6,073,534 - 6,111,928 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	5,193,565 - 5,233,656 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	16,951,517 - 16,991,685 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	16,750,761 - 16,991,653 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	2	16,184,372 - 16,224,447 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	16,588,956 - 16,629,062 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	7,324,844 - 7,358,505 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936613	1,875,044 - 1,907,271 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936613	1,875,366 - 1,909,080 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	38,970,586 - 39,004,971 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	38,970,381 - 39,004,975 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	53,835,490 - 53,867,558 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	27,048,653 - 27,085,034 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	27,048,647 - 27,082,924 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	33,068,806 - 33,105,257 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624805	5,918,956 - 5,956,206 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab18
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	29,077,298 - 29,109,691 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab18
177 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	789
Count of miRNA genes:	329
Interacting mature miRNAs:	442
Transcripts:	ENSRNOT00000025828
Prediction methods:	Microtar, Miranda, Pita, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	49496932	65155015	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat

Markers in Region

RH127782

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	54,975,801 - 54,976,001 (+)	MAPPER	mRatBN7.2
mRatBN7.2	15	88,408,082 - 88,408,281 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	96,363,479 - 96,363,677	NCBI	Rnor6.0
Rnor_6.0	17	59,876,481 - 59,876,680	NCBI	Rnor6.0
Rnor_5.0	17	61,664,553 - 61,664,752	UniSTS	Rnor5.0
Rnor_5.0	15	99,842,916 - 99,843,114	UniSTS	Rnor5.0
RGSC_v3.4	15	95,953,590 - 95,953,788	UniSTS	RGSC3.4
RGSC_v3.4	17	63,529,433 - 63,529,632	UniSTS	RGSC3.4
Celera	17	56,315,712 - 56,315,911	UniSTS
Celera	15	87,405,823 - 87,406,021	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

RH137824

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	54,961,970 - 54,962,109 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	59,862,535 - 59,862,673	NCBI	Rnor6.0
Rnor_5.0	17	61,650,607 - 61,650,745	UniSTS	Rnor5.0
RGSC_v3.4	17	63,515,678 - 63,515,816	UniSTS	RGSC3.4
Celera	17	56,301,896 - 56,302,034	UniSTS
RH 3.4 Map	17	537.69	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025828 ⟹ ENSRNOP00000025828

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	59,639,227 - 59,671,095 (+)	Ensembl
mRatBN7.2 Ensembl	17	54,944,214 - 54,976,037 (+)	Ensembl
Rnor_6.0 Ensembl	17	59,844,781 - 59,876,164 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095005 ⟹ ENSRNOP00000097816

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	59,639,206 - 59,672,806 (+)	Ensembl
mRatBN7.2 Ensembl	17	54,944,163 - 54,976,043 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095659 ⟹ ENSRNOP00000093959

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	59,639,308 - 59,672,806 (+)	Ensembl
mRatBN7.2 Ensembl	17	54,949,379 - 54,976,041 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112323 ⟹ ENSRNOP00000095343

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	59,639,203 - 59,670,649 (+)	Ensembl
mRatBN7.2 Ensembl	17	54,943,955 - 54,975,896 (+)	Ensembl

RefSeq Acc Id:

NM_001012468 ⟹ NP_001012486

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	59,639,264 - 59,670,653 (+)	NCBI
mRatBN7.2	17	54,944,217 - 54,975,602 (+)	NCBI
Dahl_SR_JrHsd	17	60,941,308 - 60,972,757 (+)	NCBI
Lyon_Normotensive	17	60,374,917 - 60,406,372 (+)	NCBI
Lyon_Hypertensive	17	57,953,905 - 57,985,281 (+)	NCBI
F344_StmMcwi	17	59,034,611 - 59,065,963 (+)	NCBI
Rnor_6.0	17	59,844,781 - 59,876,170 (+)	NCBI
Rnor_5.0	17	61,632,659 - 61,664,794 (+)	NCBI
RGSC_v3.4	17	63,497,924 - 63,529,233 (+)	RGD
Celera	17	56,284,171 - 56,315,512 (+)	RGD

Sequence:

show sequence

CACTGACTGGCACCGAGGCAGGGTCGGAGTAGAGCGGGTGCAGGATGGACGAGGACGTGCTGAC
CACTCTGAAGATCCTCATCATTGGCGAGAGTGGGGTGGGCAAGTCCAGCCTGCTCCTGAGGTTC
ACAGACGACACCTTTGATCCAGAACTTGCAGCAACAATAGGTGTTGACTTTAAGGTGAAAACGA
TTTCAGTGGATGGAAATAAGGCTAAACTTGCAATATGGGATACAGCTGGTCAAGAAAGGTTCAG
AACATTAACTCCCAGCTATTATAGAGGTGCACAGGGAGTTATATTAGTCTATGATGTCACAAGA
AGAGACACCTTTGTTAAACTGGATAATTGGTTAAATGAATTGGAAACATACTGTACAAGAAATG
ACATAGTAAACATGCTAGTTGGAAATAAAATTGATAAGGAAAACCGTGAAGTCGATAGAAATGA
AGGCTTGAAATTTGCACGCAAGCATTCTATGTTGTTCATAGAGGCAAGTGCAAAAACCTGTGAT
GGTGTTCAGTGTGCCTTTGAGGAGCTGGTTGAAAAGATCATCCAGACACCTGGACTGTGGGAAA
GTGAGAACCAGAACAAAGGAGTCAAGCTGTCCCCCAGGGAGGAGAGCCACGGGGGAGGAGCCTG
TGGCGGTTACTGTTCTGTGCTATAAACTCTGGGAAGCCGTCTCTTGCATATTGGATCGGATAGT
GATATCTCTCTGTATATAAACTCTTAACTGCTAATAGGGACCTTGCAGTTTGCACATAATTGTT
TTTATCATGGCAGTGAGTATTTGCAAGAAACCCCTCGTTGGCTTTCCCAGGTGAAGCGGTGTGG
TAAGCATGCAGTTTGCAGTCTATGGGGTTTTTTGAGGGGGGGGTTGTTTTTGTTTTTGTTTTTG
GTGTTTTTTGTTTTGGGTTTTTATGTAACGTAAAATAGATGTACCTTCATGAGTACATTTGATT
TTATGATTTACATTTATCATGTCATTTTAAAAACATCTGTCTAGTATGTGTTGCTGCAAGTCTG
CTTTTGTTTTCCCTTTTGCTTAATTACTGAATTACTTGGTATGTAGAACTAGAACCATGGGGAG
GTTCCCCTTGAGGAATAACAAAGCATGATTCACAGCTTTTCTAGGATGTTTTAGAGTCTTAGTA
CTAAGTAAAATTCTCAGTTCAGAATATAGCCCAGGCCAATTCCTAATTAAATCTCTATTTGTTC
TGATGATGCTTCCAAAATAGTATTGCTAATTTAAGGAAGTTTGGTATTTACTTTACTCCATGAT
TAGCTCAGTTATCCAGACATTAACCCCGTGTTGCACACACTGGGTTCCTGGTCTTGGTGCAGTG
TTTTGGTTACATGGCATCAGGCAGGCTTTCCTCCATTTGGGTTTCAGAAGAACATAAACAGTGT
ATTACAGCTCCTTTAATACTCCACTTTAAAACCAACGTGCTTTTTCACACGTGTTGGTAGTGTT
TGTCCAGGTGCCTCAGTTGTAACTTGTTGTGTAATGACTGTCTGTATCTTATGGCTTCCATAAA
TGGCTAGTTGCTATTCAGAAACACATTTTTGTGATTTGAAGATGGGGAAGGGAAACACTATAAA
TGACAATTTGAGAAATGTCTGTTGTTCCAAACTCTGACTGGCGGGGAGATGCTATTGCAGTGAG
ATCGTTGATAAGTTACTGTAACAAGTAGCCACTAGTTTGTTAAAAACCAACCTGTACAGATTAA
TAAACTTTTTCCACAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012486	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89957	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000097816
GenBank Protein	Q5EB77	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012486 ⟸ NM_001012468

- UniProtKB:

Q5EB77 (UniProtKB/Swiss-Prot), A6KPM0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDT
AGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKEN
REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSPREE
SHGGGACGGYCSVL

hide sequence

Ensembl Acc Id:

ENSRNOP00000025828 ⟸ ENSRNOT00000025828

Ensembl Acc Id:

ENSRNOP00000095343 ⟸ ENSRNOT00000112323

Ensembl Acc Id:

ENSRNOP00000097816 ⟸ ENSRNOT00000095005

Ensembl Acc Id:

ENSRNOP00000093959 ⟸ ENSRNOT00000095659

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5EB77-F1-model_v2	AlphaFold	Q5EB77	1-206	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700534

Promoter ID:

EPDNEW_R11058

Type:

initiation region

Name:

Rab18_1

Description:

RAB18, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	59,844,734 - 59,844,794	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308905	AgrOrtholog
BioCyc Gene	G2FUF-8971	BioCyc
Ensembl Genes	ENSRNOG00000018972	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000095005	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7312864	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab	UniProtKB/Swiss-Prot
	Sigma_54_int_dom_ATP-bd_1	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:307039	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109292	IMAGE-MGC_LOAD
NCBI Gene	307039	ENTREZGENE
PANTHER	RAS-RELATED PROTEIN RAB	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab18	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018972	RatGTEx
SMART	ARF	UniProtKB/Swiss-Prot
	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I6AQ17_RAT	UniProtKB/TrEMBL
	A0A8I6B6B8_RAT	UniProtKB/TrEMBL
	A0A8I6GKW8_RAT	UniProtKB/TrEMBL
	A0A8L2QDQ1_RAT	UniProtKB/TrEMBL
	A6KPM0	ENTREZGENE, UniProtKB/TrEMBL
	Q5EB77	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Rab18	RAB18, member RAS oncogene family	Rab18_predicted	RAB18, member RAS oncogene family (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rab18_predicted	RAB18, member RAS oncogene family (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM