Advanced Search (OLGA)

Gene: Cdk2ap1 (cyclin-dependent kinase 2 associated protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cdk2ap1

Name:

cyclin-dependent kinase 2 associated protein 1

RGD ID:

1308664

Description:

Predicted to enable DNA polymerase binding activity. Predicted to be involved in positive regulation of protein phosphorylation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within face morphogenesis and in utero embryonic development. Predicted to be located in several cellular components, including chromatin; nucleoplasm; and perinuclear region of cytoplasm. Predicted to be part of NuRD complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human CDK2AP1 (cyclin dependent kinase 2 associated protein 1); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CDK2 (cyclin-dependent kinase 2)-associated protein 1; CDK2-associated protein 1; cyclin-dependent kinase 2-associated protein 1; LOC360804

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Cdk2ap1-ps1 Cdk2ap1-ps2 Cdk2ap1-ps3 Cdk2ap1-ps4 Cdk2ap1-ps5 Cdk2ap1-ps6 Cdk2ap1-ps7 Cdk2ap1-ps8

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,910,718 - 37,919,446 (+)	NCBI		GRCr8
mRatBN7.2	12	32,249,752 - 32,258,483 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,249,747 - 32,258,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,429,132 - 33,437,872 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,040,461 - 34,049,199 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,092,339 - 33,101,075 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,668,369 - 37,677,067 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,668,369 - 37,677,063 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,538,931 - 39,539,222 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	12	39,545,402 - 39,549,786 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,365,372 - 33,374,597 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,228,844 - 33,237,985 (+)	NCBI
Celera	12	33,942,086 - 33,946,470 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdk2ap1	Rat	short chain acyl-CoA dehydrogenase deficiency		ISO	CDK2AP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of butyryl-CoA dehydrogenase	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdk2ap1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CDK2AP1 mRNA	CTD	PMID:22206623
Cdk2ap1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Cdk2ap1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of CDK2AP1 mRNA]	CTD	PMID:22206623
Cdk2ap1	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of CDK2AP1 mRNA	CTD	PMID:17108234
Cdk2ap1	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of CDK2AP1 mRNA	CTD	PMID:32145629
Cdk2ap1	Rat	17beta-estradiol	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Estradiol results in increased expression of CDK2AP1 mRNA	CTD	PMID:39298647
Cdk2ap1	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Metribolone results in increased expression of CDK2AP1 mRNA	CTD	PMID:17010196
Cdk2ap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CDK2AP1 mRNA	CTD	PMID:24680724
Cdk2ap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of CDK2AP1 mRNA	CTD	PMID:34747641
Cdk2ap1	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of CDK2AP1 mRNA	CTD	PMID:18648102
Cdk2ap1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CDK2AP1 mRNA	CTD	PMID:30047161
Cdk2ap1	Rat	aflatoxin B1	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of CDK2AP1 mRNA	CTD	PMID:22100608
Cdk2ap1	Rat	all-trans-retinoic acid	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Tretinoin results in decreased expression of CDK2AP1 mRNA	CTD	PMID:33167477
Cdk2ap1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of CDK2AP1 mRNA	CTD	PMID:30047161
Cdk2ap1	Rat	antirheumatic drug	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of CDK2AP1 mRNA	CTD	PMID:24449571
Cdk2ap1	Rat	arsenite(3-)	multiple interactions	ISO	CDK2AP1 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to CDK2AP1 mRNA]	CTD	PMID:32406909
Cdk2ap1	Rat	atrazine	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Atrazine results in decreased expression of CDK2AP1 mRNA	CTD	PMID:22378314
Cdk2ap1	Rat	benzo[a]pyrene	affects methylation	ISO	CDK2AP1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of CDK2AP1 promoter	CTD	PMID:27901495
Cdk2ap1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of CDK2AP1 mRNA	CTD	PMID:33754040
Cdk2ap1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CDK2AP1 mRNA	CTD	PMID:25181051
Cdk2ap1	Rat	bisphenol A	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	bisphenol A results in decreased expression of CDK2AP1 mRNA	CTD	PMID:35598803
Cdk2ap1	Rat	bisphenol A	multiple interactions	ISO	CDK2AP1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CDK2AP1 gene	CTD	PMID:31601247
Cdk2ap1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CDK2AP1 mRNA	CTD	PMID:32145629
Cdk2ap1	Rat	bisphenol A	affects expression	ISO	CDK2AP1 (Homo sapiens)	6480464	bisphenol A affects the expression of CDK2AP1 mRNA	CTD	PMID:30903817
Cdk2ap1	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of CDK2AP1 mRNA	CTD	PMID:19167457
Cdk2ap1	Rat	carbon nanotube	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Cdk2ap1	Rat	chromium(6+)	affects expression	ISO	Cdk2ap1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of CDK2AP1 mRNA	CTD	PMID:28472532
Cdk2ap1	Rat	cisplatin	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Cisplatin results in increased expression of CDK2AP1 mRNA	CTD	PMID:19561079 and PMID:27594783
Cdk2ap1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of CDK2AP1 mRNA	CTD	PMID:24386269
Cdk2ap1	Rat	cobalt dichloride	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of CDK2AP1 mRNA	CTD	PMID:19320972
Cdk2ap1	Rat	cyclosporin A	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of CDK2AP1 mRNA	CTD	PMID:25562108 and PMID:27989131
Cdk2ap1	Rat	cyclosporin A	decreases methylation	ISO	CDK2AP1 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of CDK2AP1 promoter	CTD	PMID:27989131
Cdk2ap1	Rat	dibutyl phthalate	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of CDK2AP1 mRNA	CTD	PMID:17361019 and PMID:21266533
Cdk2ap1	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of CDK2AP1 mRNA	CTD	PMID:24136188
Cdk2ap1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of CDK2AP1 mRNA	CTD	PMID:24136188
Cdk2ap1	Rat	folic acid	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Folic Acid results in decreased expression of CDK2AP1 mRNA	CTD	PMID:25629700
Cdk2ap1	Rat	folic acid	multiple interactions	ISO	Cdk2ap1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of CDK2AP1 mRNA]	CTD	PMID:22206623
Cdk2ap1	Rat	fulvestrant	multiple interactions	ISO	CDK2AP1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CDK2AP1 gene	CTD	PMID:31601247
Cdk2ap1	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of CDK2AP1 mRNA	CTD	PMID:24136188
Cdk2ap1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of CDK2AP1 mRNA	CTD	PMID:30047161
Cdk2ap1	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of CDK2AP1 mRNA	CTD	PMID:22546817
Cdk2ap1	Rat	paracetamol	affects expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Acetaminophen affects the expression of CDK2AP1 mRNA	CTD	PMID:17562736
Cdk2ap1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CDK2AP1 mRNA	CTD	PMID:33387578
Cdk2ap1	Rat	pentachlorophenol	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of CDK2AP1 mRNA	CTD	PMID:23892564
Cdk2ap1	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of CDK2AP1 mRNA	CTD	PMID:30047161
Cdk2ap1	Rat	PhIP	increases expression	EXP		6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of CDK2AP1 mRNA	CTD	PMID:15215175
Cdk2ap1	Rat	pinosylvin	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	pinosylvin results in decreased expression of CDK2AP1 mRNA	CTD	PMID:23333577
Cdk2ap1	Rat	pirinixic acid	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	pirinixic acid results in increased expression of CDK2AP1 mRNA	CTD	PMID:23811191
Cdk2ap1	Rat	propiconazole	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	propiconazole results in increased expression of CDK2AP1 mRNA	CTD	PMID:21278054
Cdk2ap1	Rat	sodium arsenite	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of CDK2AP1 mRNA	CTD	PMID:34032870
Cdk2ap1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of CDK2AP1 mRNA	CTD	PMID:30047161
Cdk2ap1	Rat	temozolomide	increases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Temozolomide results in increased expression of CDK2AP1 mRNA	CTD	PMID:31758290
Cdk2ap1	Rat	titanium dioxide	increases methylation	ISO	Cdk2ap1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of CDK2AP1 gene	CTD	PMID:35295148
Cdk2ap1	Rat	trans-pinosylvin	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	pinosylvin results in decreased expression of CDK2AP1 mRNA	CTD	PMID:23333577
Cdk2ap1	Rat	Tributyltin oxide	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	bis(tri-n-butyltin)oxide results in decreased expression of CDK2AP1 mRNA	CTD	PMID:18958704
Cdk2ap1	Rat	trimellitic anhydride	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of CDK2AP1 mRNA	CTD	PMID:19042947
Cdk2ap1	Rat	triptonide	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	triptonide results in increased expression of CDK2AP1 mRNA	CTD	PMID:33045310
Cdk2ap1	Rat	tungsten	increases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Tungsten results in increased expression of CDK2AP1 mRNA	CTD	PMID:30912803
Cdk2ap1	Rat	valproic acid	decreases expression	ISO	Cdk2ap1 (Mus musculus)	6480464	Valproic Acid results in decreased expression of CDK2AP1 mRNA	CTD	PMID:20546886 and PMID:21427059
Cdk2ap1	Rat	valproic acid	affects expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Valproic Acid affects the expression of CDK2AP1 mRNA	CTD	PMID:25979313
Cdk2ap1	Rat	valproic acid	increases methylation	ISO	CDK2AP1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of CDK2AP1 gene	CTD	PMID:29154799
Cdk2ap1	Rat	valproic acid	decreases expression	ISO	CDK2AP1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of CDK2AP1 mRNA	CTD	PMID:28001369 and PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdk2ap1	Rat	face morphogenesis	acts_upstream_of_or_within	ISO	Cdk2ap1 (Mus musculus)	1624291	MGI:3512185 PMID:19229340	RGD	PMID:19229340
Cdk2ap1	Rat	in utero embryonic development	acts_upstream_of_or_within	ISO	Cdk2ap1 (Mus musculus)	1624291	MGI:3512185 PMID:19229340	RGD	PMID:19229340
Cdk2ap1	Rat	positive regulation of protein phosphorylation	involved_in	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:9506968	RGD	PMID:9506968
Cdk2ap1	Rat	regulation of transcription by RNA polymerase II	involved_in	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:20523938	RGD	PMID:20523938

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdk2ap1	Rat	chromatin	located_in	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:20523938	RGD	PMID:20523938
Cdk2ap1	Rat	cytoplasm	is_active_in	IBA	MGI:1098779 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdk2ap1	Rat	cytosol	located_in	ISO	CDK2AP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Cdk2ap1	Rat	nucleoplasm	located_in	ISO	CDK2AP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Cdk2ap1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Cdk2ap1	Rat	nucleus	is_active_in	IBA	MGI:1098779 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdk2ap1	Rat	nucleus	located_in	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:20523938 more ...	RGD	PMID:20523938 more ...
Cdk2ap1	Rat	NuRD complex	part_of	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:20523938 and PMID:33283408	RGD	PMID:20523938 and PMID:33283408
Cdk2ap1	Rat	perinuclear region of cytoplasm	located_in	ISO	CDK2AP1 (Homo sapiens)	1624291	PMID:9506968	RGD	PMID:9506968

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdk2ap1	Rat	DNA polymerase binding	enables	ISO	CDK2AP1 (Homo sapiens)	1624291	UniProtKB:P09884 and PMID:9506968	RGD	PMID:9506968
Cdk2ap1	Rat	protein binding	enables	ISO	CDK2AP1 (Homo sapiens)	1624291	UniProtKB:B2RBV5 more ...	RGD	PMID:14985111 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9506968	PMID:12477932	PMID:19229340

Cdk2ap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,910,718 - 37,919,446 (+)	NCBI		GRCr8
mRatBN7.2	12	32,249,752 - 32,258,483 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,249,747 - 32,258,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,429,132 - 33,437,872 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,040,461 - 34,049,199 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,092,339 - 33,101,075 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,668,369 - 37,677,067 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,668,369 - 37,677,063 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,538,931 - 39,539,222 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	12	39,545,402 - 39,549,786 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,365,372 - 33,374,597 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,228,844 - 33,237,985 (+)	NCBI
Celera	12	33,942,086 - 33,946,470 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

CDK2AP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	123,260,976 - 123,272,240 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	123,250,112 - 123,272,334 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	123,745,523 - 123,756,787 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	122,311,491 - 122,322,640 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	122,270,420 - 122,281,567	NCBI
Celera	12	123,337,112 - 123,348,266 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,706,698 - 120,717,993 (-)	NCBI		HuRef
CHM1_1	12	123,713,797 - 123,725,124 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	123,257,499 - 123,268,761 (-)	NCBI		T2T-CHM13v2.0

Cdk2ap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,483,502 - 124,492,691 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,483,480 - 124,501,145 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	124,345,439 - 124,354,628 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	124,345,417 - 124,363,082 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	124,795,448 - 124,804,637 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,606,057 - 124,615,246 (-)	NCBI		MGSCv36	mm8
Celera	5	121,420,899 - 121,429,855 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.53	NCBI

Cdk2ap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,588,674 - 5,593,896 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	5,588,683 - 5,593,896 (+)	NCBI	ChiLan1.0	ChiLan1.0

CDK2AP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	131,348,690 - 131,359,527 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	131,345,066 - 131,355,880 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	120,859,240 - 120,870,443 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	125,092,593 - 125,103,452 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

CDK2AP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,283,071 - 6,293,595 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	52,363,464 - 52,363,811 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	26	6,284,535 - 6,293,591 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,445,257 - 6,455,733 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,532,579 - 6,543,449 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,532,966 - 6,543,449 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,466,330 - 6,476,809 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	6,558,200 - 6,568,672 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,511,768 - 6,522,244 (+)	NCBI		UU_Cfam_GSD_1.0

Cdk2ap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	158,010,726 - 158,020,573 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936558	1,458,885 - 1,468,698 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDK2AP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	29,631,084 - 29,642,253 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	29,631,084 - 29,642,262 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,321,811 - 31,332,455 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDK2AP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,602,354 - 118,613,006 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,603,089 - 118,612,971 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	126,696,959 - 126,708,401 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdk2ap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	23,195,459 - 23,205,387 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	23,195,459 - 23,205,612 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cdk2ap1
61 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	56
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000001419
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

RH127739

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,258,656 - 32,258,851 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,677,241 - 37,677,435	NCBI	Rnor6.0
Rnor_5.0	12	39,549,962 - 39,550,156	UniSTS	Rnor5.0
RGSC_v3.4	12	33,374,773 - 33,374,967	UniSTS	RGSC3.4
Celera	12	33,946,646 - 33,946,840	UniSTS
RH 3.4 Map	12	566.9	UniSTS
Cytogenetic Map	12	q15	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001113751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001419 ⟹ ENSRNOP00000001419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,253,140 - 32,258,479 (+)	Ensembl
Rnor_6.0 Ensembl	12	37,668,369 - 37,677,063 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100788 ⟹ ENSRNOP00000084668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,254,789 - 32,258,479 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107655 ⟹ ENSRNOP00000078090

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,249,747 - 32,258,474 (+)	Ensembl

RefSeq Acc Id:

NM_001113751 ⟹ NP_001107223

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,910,718 - 37,919,446 (+)	NCBI
mRatBN7.2	12	32,249,752 - 32,258,483 (+)	NCBI
Rnor_6.0	12	37,668,369 - 37,677,065 (+)	NCBI
Rnor_5.0	12	39,538,931 - 39,539,222 (+)	NCBI
Rnor_5.0	12	39,545,402 - 39,549,786 (+)	NCBI
RGSC_v3.4	12	33,365,372 - 33,374,597 (+)	RGD
Celera	12	33,942,086 - 33,946,470 (+)	RGD

Sequence:

show sequence

CGCGCCCGATGTATGGGTGATATACTGCGGCGGCGGCAGGGTGAGGGACGGCCATATTTGCCGGCGCGGCCCGAGCCGGCGACAACAAAAAGTGCGCGGGCTCCCGGCAGGCGCTCGGACGGGTGCGG
GGACGTGGGGCCGCCCGGCCCGGGCCTCGGCCTCGGCCTCGCCGCCGCCGCTGCGCTCGCGGCCTGGCCCGGCTCTGCCCGGCGCGCCCGCCGCCCGCGGGGATGTCGTACAAGCCGAACTTGACCGC
GCACATGCCCGCCGCCGCCCTCAACGCCGGGAGTGTCCATTCACCGTCTACTAGCATGGCGACCTCCTCCCAGTATCGCCAGCTGCTGAGTGACTATGGGCCTCCATCGCTAGGCTACACCCAGGGAA
CTGGAAATAGCCAGGTGCCTCAGAGTAAATATGCAGAGCTGCTGGCCATCATTGAAGAGTTGGGGAAAGAGATCAGACCCACGTATGCAGGGAGCAAGAGTGCCATGGAGAGGCTAAAACGAGGCATC
ATTCATGCCCGAAGCCTGGTTCGGGAGTGCTTGGCTGAAACGGAACGGAACGCCAGGTCCTAGCCCCTGGCCAGTCTGCAGGCCCATCTCTACCCCATGGAGATGAGAGGCTTTGTTCAAAATGGCAG
TAATTTTTCTACCACAGTCATTAAGCTCTGAACCCACACTCAAAAGATTGGGAAGACATTTTGCAGTAACTGACGATGTGCATTTTAAGTAGTTAGGAATGACCCAGCTCTTTTTTCTTTTCAAGCAT
TTGAAAGATGTTTGTCAAGCCACTTCACAGCAAGCTATTGTTTGTCCCCAAATACCAGTGTCCCCTTTAACCTCCCTTTGGATACATTTTCCATTTGCATCACCCCAGTTGACTTCCTTTCCATGAGC
TCACCTGCCTCTGAGGAGTTGAGTGCAGACCACAGCACGTTTGCTTAGTAGCTGGCCTGCCTGTGTACAGTGTAGACCCTGCTTCACGGAGCTTCTCTGCTTAAGCGTTTGCATGACTGAGTGCTTTG
AAGTCAATCTTTAAAATGCACAGGTTATAAATACAGAAGAAAGAGCAATCCACCCAACCTACCAAGCACCCTGCAAATGTCCGTCCTGAGACTAGATCTCAGTTCCGTGTTTACTGTGAGCCGATCAC
AACATCTGGAAGAAAACGACTGAAACGTTGCATCTTTGTATTTATTACTTGATGTAATAAAGCTTATTTTCATTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001401014 ⟹ NP_001387943

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,914,011 - 37,919,446 (+)	NCBI
mRatBN7.2	12	32,253,045 - 32,258,483 (+)	NCBI

RefSeq Acc Id:

XM_008769239 ⟹ XP_008767461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,911,835 - 37,919,444 (+)	NCBI
mRatBN7.2	12	32,250,880 - 32,258,483 (+)	NCBI
Rnor_6.0	12	37,670,537 - 37,677,067 (+)	NCBI

Sequence:

show sequence

CCCAGGCCCAGGCCGCTCTTTGTCTGGCGTGGGGGCGGGGAGCTGAGCCTGGCCCCAGGAGCTTCCTGGCCTCTGCCAAGCCCTCTCAGCTCTCTGCACACTGCGCTCATTGTCTGAGATGCTCCACA
CCGGCTGAGCTGACGTGGAACCGCCTCCCTGGCCTCTTTCAGCCCAGGTGCTGGTGTCTTACAGAAGGAGAGGGCATGAGTGGCGGAGGAGCACCCTTCCACCCCGACTCCCCAGGGGGGCAGACATC
TTCCTATTAATGAATAGGGTGCTGGCTTTGACACAAAGTCAGGTTCATCTCCACTCCTCCAGGGTGATACCAGGCTTGAGGTCCTCTGCCAGTATGGGGGTACTTCTCATTCCTTCTTTACCCTCAGC
CCCTTAAGGGCATTCCCAACGTCATTAATCCTTCTACTGGGGAGCATGGCCTCAAACAAGTGGAGAAACTGAGCCCCGGAAGAGCCTTGACAGGTCCCACCGCCAGGAGTGGCACTGCTGGGACAGAC
TCCCAAGTCCAGGAGAAAAGATGTGACAGGGAGGGAGTGTCCATTCACCGTCTACTAGCATGGCGACCTCCTCCCAGTATCGCCAGCTGCTGAGTGACTATGGGCCTCCATCGCTAGGCTACACCCAG
GGAACTGGAAATAGCCAGGTGCCTCAGAGTAAATATGCAGAGCTGCTGGCCATCATTGAAGAGTTGGGGAAAGAGATCAGACCCACGTATGCAGGGAGCAAGAGTGCCATGGAGAGGCTAAAACGAGG
CATCATTCATGCCCGAAGCCTGGTTCGGGAGTGCTTGGCTGAAACGGAACGGAACGCCAGGTCCTAGCCCCTGGCCAGTCTGCAGGCCCATCTCTACCCCATGGAGATGAGAGGCTTTGTTCAAAATG
GCAGTAATTTTTCTACCACAGTCATTAAGCTCTGAACCCACACTCAAAAGATTGGGAAGACATTTTGCAGTAACTGACGATGTGCATTTTAAGTAGTTAGGAATGACCCAGCTCTTTTTTCTTTTCAA
GCATTTGAAAGATGTTTGTCAAGCCACTTCACAGCAAGCTATTGTTTGTCCCCAAATACCAGTGTCCCCTTTAACCTCCCTTTGGATACATTTTCCATTTGCATCACCCCAGTTGACTTCCTTTCCAT
GAGCTCACCTGCCTCTGAGGAGTTGAGTGCAGACCACAGCACGTTTGCTTAGTAGCTGGCCTGCCTGTGTACAGTGTAGACCCTGCTTCACGGAGCTTCTCTGCTTAAGCGTTTGCATGACTGAGTGC
TTTGAAGTCAATCTTTAAAATGCACAGGTTATAAATACAGAAGAAAGAGCAATCCACCCAACCTACCAAGCACCCTGCAAATGTCCGTCCTGAGACTAGATCTCAGTTCCGTGTTTACTGTGAGCCGA
TCACAACATCTGGAAGAAAACGACTGAAACGTTGCATCTTTGTATTTATTACTTGATGTAATAAAGCTTATTTTCATTAACA

hide sequence

RefSeq Acc Id:

XM_039089595 ⟹ XP_038945523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,915,226 - 37,919,444 (+)	NCBI
mRatBN7.2	12	32,254,274 - 32,258,483 (+)	NCBI

RefSeq Acc Id:

XM_063271533 ⟹ XP_063127603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,911,569 - 37,919,444 (+)	NCBI


Protein RefSeqs	NP_001107223	(Get FASTA)	NCBI Sequence Viewer
	NP_001387943	(Get FASTA)	NCBI Sequence Viewer
	XP_008767461	(Get FASTA)	NCBI Sequence Viewer
	XP_038945523	(Get FASTA)	NCBI Sequence Viewer
	XP_063127603	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58684	(Get FASTA)	NCBI Sequence Viewer
	EDM13591	(Get FASTA)	NCBI Sequence Viewer
	EDM13592	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001419
	ENSRNOP00000001419.5
	ENSRNOP00000078090
	ENSRNOP00000078090.1
	ENSRNOP00000084668
	ENSRNOP00000084668.1

RefSeq Acc Id:	NP_001107223 ⟸ NM_001113751
- Peptide Label:	isoform 1
- UniProtKB:	B0BN48 (UniProtKB/TrEMBL), F7F7G5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS hide sequence

RefSeq Acc Id:	XP_008767461 ⟸ XM_008769239
- Peptide Label:	isoform X2
- Sequence:	show sequence MATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS hide sequence

Ensembl Acc Id:

ENSRNOP00000001419 ⟸ ENSRNOT00000001419

RefSeq Acc Id:	XP_038945523 ⟸ XM_039089595
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A030 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000084668 ⟸ ENSRNOT00000100788

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN48-F1-model_v2	AlphaFold	B0BN48	1-114	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698615

Promoter ID:

EPDNEW_R9139

Type:

initiation region

Name:

Cdk2ap1_1

Description:

cyclin-dependent kinase 2 associated protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	37,668,328 - 37,668,388	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-19352	BioCyc
Ensembl Genes	ENSRNOG00000001070	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001419	ENTREZGENE
	ENSRNOT00000001419.6	UniProtKB/TrEMBL
	ENSRNOT00000100788	ENTREZGENE
	ENSRNOT00000100788.1	UniProtKB/TrEMBL
	ENSRNOT00000107655	ENTREZGENE
	ENSRNOT00000107655.1	UniProtKB/TrEMBL
Gene3D-CATH	6.10.140.1300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8373627	IMAGE-MGC_LOAD
InterPro	CDK2-associated_2	UniProtKB/TrEMBL
KEGG Report	rno:360804	UniProtKB/TrEMBL
MGC_CLONE	MGC:187692	IMAGE-MGC_LOAD
NCBI Gene	360804	ENTREZGENE
PANTHER	CYCLIN-DEPENDENT KINASE 2-ASSOCIATED PROTEIN 1	UniProtKB/TrEMBL
	PTHR22607	UniProtKB/TrEMBL
Pfam	CDK2AP	UniProtKB/TrEMBL
PhenoGen	Cdk2ap1	PhenoGen
PIRSF	CDK2-associated_p2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001070	RatGTEx
UniProt	A0A8I6A030	ENTREZGENE, UniProtKB/TrEMBL
	B0BN48	ENTREZGENE, UniProtKB/TrEMBL
	F7F7G5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Cdk2ap1	cyclin-dependent kinase 2 associated protein 1	LOC687549	similar to CDK2 (cyclin-dependent kinase 2)-associated protein 1	Data merged from RGD:1584216	1643240	APPROVED
2011-08-01	Cdk2ap1	cyclin-dependent kinase 2 associated protein 1	Cdk2ap1	CDK2-associated protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-02-04	Cdk2ap1	CDK2-associated protein 1	Cdk2ap1	cyclin-dependent kinase 2-associated protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-29	Cdk2ap1	cyclin-dependent kinase 2-associated protein 1	Cdk2ap1	CDK2 (cyclin-dependent kinase 2)-associated protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Cdk2ap1	CDK2 (cyclin-dependent kinase 2)-associated protein 1	Cdk2ap1_predicted	CDK2 (cyclin-dependent kinase 2)-associated protein 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-19	LOC687549	similar to CDK2 (cyclin-dependent kinase 2)-associated protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Cdk2ap1_predicted	CDK2 (cyclin-dependent kinase 2)-associated protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar