Advanced Search (OLGA)

Gene: Mrgbp (MRG domain binding protein) Rattus norvegicus

Analyze

Symbol:

Mrgbp

Name:

MRG domain binding protein

RGD ID:

1308612

Description:

Predicted to be involved in positive regulation of double-strand break repair via homologous recombination; regulation of cell cycle; and regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of NuA4 histone acetyltransferase complex and nucleosome. Orthologous to human MRGBP (MRG domain binding protein); PARTICIPATES IN INO80 family mediated chromatin remodeling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; azoxystrobin; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC311713; MGC116321; MRG-binding protein; MRG/MORF4L binding protein; NEWGENE_1308612; RGD1308612; similar to Protein C20orf20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRGBP (MRG domain binding protein)	RGD	RGD
Mus musculus (house mouse):	Mrgbp (MRG/MORF4L binding protein)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Mrgbp (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRGBP (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRGBP (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrgbp (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRGBP (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRGBP (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrgbp (MRG domain binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MRGBP (MRG domain binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrgbp (MRG/MORF4L binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrgbp (MRG/MORF4L binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	EAF7	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	MrgBP	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK1127.3	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	188,074,695 - 188,078,162 (+)	NCBI		GRCr8
mRatBN7.2	3	167,697,129 - 167,700,592 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	167,697,185 - 167,700,592 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	172,077,260 - 172,080,666 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	181,036,351 - 181,039,757 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	177,698,111 - 177,701,518 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	175,924,456 - 175,927,925 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	176,087,700 - 176,090,268 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	3	175,924,522 - 175,927,935 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	179,788,307 - 179,791,770 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	169,673,768 - 169,677,181 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	164,881,953 - 164,885,360 (-)	NCBI		Celera
Cytogenetic Map	3	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

developmental and epileptic encephalopathy (ISO)

developmental and epileptic encephalopathy 33 (ISO)

early infantile epileptic encephalopathy (ISO)

epilepsy (ISO)

neuronal ceroid lipofuscinosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

caffeine (ISO)

chlorpyrifos (EXP,ISO)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

FR900359 (ISO)

glyphosate (EXP)

imidacloprid (EXP)

ivermectin (ISO)

mono(2-ethylhexyl) phthalate (ISO)

pentachlorophenol (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

thiabendazole (EXP)

thiram (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

chromatin organization (IEA)

positive regulation of double-strand break repair via homologous recombination (ISO)

regulation of cell cycle (ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

NuA4 histone acetyltransferase complex (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleosome (ISO)

nucleus (IEA)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

INO80 family mediated chromatin remodeling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Mrgbp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	188,074,695 - 188,078,162 (+)	NCBI		GRCr8
mRatBN7.2	3	167,697,129 - 167,700,592 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	167,697,185 - 167,700,592 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	172,077,260 - 172,080,666 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	181,036,351 - 181,039,757 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	177,698,111 - 177,701,518 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	175,924,456 - 175,927,925 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	176,087,700 - 176,090,268 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	3	175,924,522 - 175,927,935 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	179,788,307 - 179,791,770 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	169,673,768 - 169,677,181 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	164,881,953 - 164,885,360 (-)	NCBI		Celera
Cytogenetic Map	3	q43	NCBI

MRGBP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	62,796,473 - 62,801,729 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	62,796,473 - 62,801,729 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	61,427,825 - 61,433,081 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	60,898,283 - 60,902,390 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	60,898,282 - 60,902,385	NCBI
Celera	20	58,103,435 - 58,107,575 (+)	NCBI		Celera
Cytogenetic Map	20	q13.33	NCBI
HuRef	20	58,146,494 - 58,149,978 (+)	NCBI		HuRef
CHM1_1	20	61,328,199 - 61,332,994 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	64,595,441 - 64,600,697 (+)	NCBI		T2T-CHM13v2.0

Mrgbp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	180,222,990 - 180,228,097 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	180,223,097 - 180,228,097 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	180,581,198 - 180,586,304 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	180,581,304 - 180,586,304 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	180,316,009 - 180,320,339 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	180,512,120 - 180,515,713 (+)	NCBI		MGSCv36	mm8
Celera	2	184,667,167 - 184,671,498 (+)	NCBI		Celera
Cytogenetic Map	2	H4	NCBI
cM Map	2	103.12	NCBI

Mrgbp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955528	1,320,061 - 1,324,094 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRGBP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	68,584,085 - 68,588,220 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	68,577,217 - 68,581,346 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	59,183,842 - 59,187,982 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	60,459,870 - 60,483,493 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

MRGBP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	46,634,580 - 46,637,222 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	46,634,668 - 46,637,354 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	45,816,710 - 45,822,957 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	47,505,100 - 47,511,317 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	47,504,658 - 47,510,556 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	46,602,472 - 46,609,037 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	46,725,850 - 46,732,370 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	47,480,756 - 47,488,340 (+)	NCBI		UU_Cfam_GSD_1.0

Mrgbp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	194,849,734 - 194,854,364 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	10,303,597 - 10,307,185 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	10,303,870 - 10,308,007 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRGBP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	62,058,424 - 62,062,960 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	62,058,401 - 62,062,962 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MRGBP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	1,428,152 - 1,433,228 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	1,428,796 - 1,433,148 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	49,282,255 - 49,287,337 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrgbp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	28,571,417 - 28,576,679 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	28,571,407 - 28,576,034 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrgbp
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	748
Count of miRNA genes:	226
Interacting mature miRNAs:	273
Transcripts:	ENSRNOT00000071953, ENSRNOT00000073679
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat
1300161	Rf10	Renal function QTL 10	3.57		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	3	161192952	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Markers in Region

D3Rat242

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	167,680,072 - 167,680,372 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	176,070,354 - 176,070,653	NCBI	Rnor6.0
Rnor_5.0	3	179,771,043 - 179,771,342	UniSTS	Rnor5.0
RGSC_v3.4	3	169,656,755 - 169,657,054	UniSTS	RGSC3.4
Celera	3	164,901,785 - 164,902,084	UniSTS
SHRSP x BN Map	3	91.4899	UniSTS
SHRSP x BN Map	3	91.4899	RGD
Cytogenetic Map	3	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
3	11	43	82	57	60	41	19	41	160	73	74	35	41	19

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001173739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_591927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO403993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073679 ⟹ ENSRNOP00000066113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	176,087,700 - 176,090,268 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086626 ⟹ ENSRNOP00000070225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	167,697,185 - 167,700,583 (+)	Ensembl
Rnor_6.0 Ensembl	3	175,924,522 - 175,927,935 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114736 ⟹ ENSRNOP00000088881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	167,697,200 - 167,700,592 (+)	Ensembl

RefSeq Acc Id:

NM_001173739 ⟹ NP_001167210

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	188,074,755 - 188,078,162 (+)	NCBI
mRatBN7.2	3	167,697,185 - 167,700,592 (+)	NCBI
Rnor_6.0	3	175,924,518 - 175,927,925 (+)	NCBI
Rnor_5.0	3	179,788,307 - 179,791,770 (+)	NCBI
Celera	3	164,881,953 - 164,885,360 (-)	NCBI

Sequence:

show sequence

CGGGCGCTCGTCGCTCGCCGGCGGCCATGGGGGAGGCCGAGGTAGGCGGCACGGGCGCCCCAGG
CGATAAGGGCCCAGGCGAGGCAGCCCCGAGCCCTGCTGAGGAGACGGTGGTGTGGAGCCCTGAA
GTGGAAGTGTGCCTCTTCCACGCCATGCTGGGCCACAAGCCTGTCGGGGTGAATCGACACTTCC
ACATGATTTGTATCCGAGACAAGTTCAGCCAGAATATTGGGCGCCAGGTTCCATCCAAGGTGAT
CTGGGACCATTTGAGCACTATGTACGACATGCAGGCACTGCACGAGTCTGAGATTCTGCCATTC
CCAAATCCAGAGAGGAACTTTGTCCTTCCCGATGAGATCATTCAGGAAGTCCGAGAAGGAAAAG
TGGTCATTGAAGAAGAAATGAAGGAGGAGATGAAGGAGGATGTGGACCCCCACAGTGGGGCTGA
TGACGTTTTTTCATCTTCAGGGAGCTTGGGGAAAGCATTAGAAAAATCCAGCAAAGACAAAGAG
AAGAACTCCTCAGACTTGGGGTGCAAAGAAGGGGCAGACAAGCGGAAGCGCAGCCGGGTCACTG
ACAAGGTCCTGACTGCCAACAGCAATCCCTCCAGCCCCAGTGCTGCCAAGAGGCGCCGCACATA
GACACCTCAGCCCCAGGTGGCCAAGAGATGCTCCAGCTGCCTGTCCTCAGGTCCCTGGGTGAAT
GTGGCCATCCAGCAGAGATGCTAGTGGGGCTTCCGCTGTGTCATCAGACCTCCAGAGCACTTGA
TTGGTCCAAAAGGCCAGCAAGACCGGTGTCCACTCTGCTGGATGGTGAAGCCTCTGAGCCAGCC
TCTTGCTTTCTCCTGGTCAGTTCCCTTATGCCCACAGTGTGTGGAGAAGAGCAGGTGCGTGGGC
CAGAGGACCAAGAGTCAGCAAGCAATAAGACGTCACCCTCACTGTCCTCAGGAGCCAGGCATCC
TCCCTGGGTGCCCAGTCTTTGCATCTGCTTTTCCTGTAAGACTCCATTGTGCACTGGCATCCAG
AGAAGGTGTCTTTGGAGTTCACACAGCACACACTGTGCACAGAAGGCCTCCCCCATCTGGGAAA
TAGAACTGGATATTTTGCCTCATTCACTTGTACTGTAATAGTGTATATAATTTAGTTGGTATTT
CACTATTTAATTTTTAAGAAGCCTATTTTACTAGTGTTTTGTATGAAGAAAAATACTGCAGAAG
TTAAACCTGTGATGTGTTTTTTTGAGCTGTTTTGTTTTAAGGTAACTACTGAGATACGTCTGGC
TGTTTTTATATGCCAGATACAGAGAATTTTTAGCGGTTATTTTTGTAATTTTAGTAACTTGGAA
AAGACCAAATAAGGGGGTGGAACAAAGGAACAGCCATCAGACTGAAAAGCCAGTGGCCTGATGG
CTGAAGCACATTTTCATTTGCAGGATATTAAAGCATTAAAAAACTAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

RefSeq Acc Id:

XM_063283891 ⟹ XP_063139961

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	188,074,695 - 188,078,162 (+)	NCBI

RefSeq Acc Id:

XM_063283892 ⟹ XP_063139962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	188,074,699 - 188,076,726 (+)	NCBI

RefSeq Acc Id:

XM_063283894 ⟹ XP_063139964

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	188,074,698 - 188,076,726 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001167210	(Get FASTA)	NCBI Sequence Viewer
	XP_063139961	(Get FASTA)	NCBI Sequence Viewer
	XP_063139962	(Get FASTA)	NCBI Sequence Viewer
	XP_063139964	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99155	(Get FASTA)	NCBI Sequence Viewer
	EDL88799	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070225.1
	ENSRNOP00000088881.1

RefSeq Acc Id:

NP_001167210 ⟸ NM_001173739

- UniProtKB:

G3V751 (UniProtKB/TrEMBL), A6KM92 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKF
SQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPDEIIQEVREGKVVIEEEMKE
EMKEDVDPHSGADDVFSSSGSLGKALEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSN
PSSPSAAKRRRT

hide sequence

Ensembl Acc Id:

ENSRNOP00000066113 ⟸ ENSRNOT00000073679

Ensembl Acc Id:

ENSRNOP00000070225 ⟸ ENSRNOT00000086626

Ensembl Acc Id:

ENSRNOP00000088881 ⟸ ENSRNOT00000114736

RefSeq Acc Id:	XP_063139961 ⟸ XM_063283891
- Peptide Label:	isoform X1
- UniProtKB:	A6KM93 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063139964 ⟸ XM_063283894
- Peptide Label:	isoform X3
- UniProtKB:	A6KM94 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063139962 ⟸ XM_063283892
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AAD6 (UniProtKB/TrEMBL), A6KM95 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V751-F1-model_v2	AlphaFold	G3V751	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308612	AgrOrtholog
BioCyc Gene	G2FUF-46328	BioCyc
Ensembl Genes	ENSRNOG00000045955	Ensembl
	ENSRNOG00000059891	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000086626.2	UniProtKB/TrEMBL
	ENSRNOT00000114736.1	UniProtKB/TrEMBL
InterPro	EAF7	UniProtKB/TrEMBL
KEGG Report	rno:311713	UniProtKB/TrEMBL
NCBI Gene	311713	ENTREZGENE
PANTHER	MRG/MORF4L-BINDING PROTEIN	UniProtKB/TrEMBL
	PTHR13581	UniProtKB/TrEMBL
Pfam	Eaf7	UniProtKB/TrEMBL
PhenoGen	Mrgbp	PhenoGen
RatGTEx	ENSRNOG00000045955	RatGTEx
	ENSRNOG00000059891	RatGTEx
UniProt	A0A8I6AAD6	ENTREZGENE, UniProtKB/TrEMBL
	A6KM92	ENTREZGENE, UniProtKB/TrEMBL
	A6KM93	ENTREZGENE, UniProtKB/TrEMBL
	A6KM94	ENTREZGENE, UniProtKB/TrEMBL
	A6KM95	ENTREZGENE, UniProtKB/TrEMBL
	G3V751	ENTREZGENE, UniProtKB/TrEMBL
	Q4KLK2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Mrgbp	MRG domain binding protein	NEWGENE_1308612	MRG/MORF4L binding protein	Data merged from RGD:11438794	737654	PROVISIONAL
2016-10-12	Mrgbp	MRG domain binding protein	Mrgbp	MRG/MORF4L binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-08-02	NEWGENE_1308612	MRG/MORF4L binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-11-07	Mrgbp	MRG/MORF4L binding protein	RGD1308612	similar to Protein C20orf20	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308612	similar to Protein C20orf20	RGD1308612_predicted	similar to Protein C20orf20 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308612_predicted	similar to Protein C20orf20 (predicted)	LOC311713_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC311713_predicted	similar to Protein C20orf20 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations