Advanced Search (OLGA)

Gene: Tmem38a (transmembrane protein 38a) Rattus norvegicus

Analyze

Symbol:

Tmem38a

Name:

transmembrane protein 38a

RGD ID:

1307901

Description:

Predicted to enable identical protein binding activity and potassium channel activity. Predicted to be involved in regulation of release of sequestered calcium ion into cytosol. Predicted to act upstream of or within several processes, including cellular response to caffeine; monoatomic cation transmembrane transport; and regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion. Predicted to be located in nuclear membrane and sarcoplasmic reticulum membrane. Orthologous to human TMEM38A (transmembrane protein 38A); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; aconitine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

27 kDa sarcoplasmic reticulum protein; LOC306327; RGD1307901; similar to RIKEN cDNA 1110001E17; SPR-27; Srp-27; TRIC-A; TRICA; trimeric intracellular cation channel type A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM38A (transmembrane protein 38A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Tmem38a (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem38a (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM38A (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM38A (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem38a (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM38A (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103234112 (trimeric intracellular cation channel type A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem38a (transmembrane protein 38A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TMEM38A (transmembrane protein 38A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmem38a (transmembrane protein 38A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem38a (transmembrane protein 38A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tric-1B.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4239	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem38a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	17,292,215 - 17,307,704 (-)	NCBI		GRCr8
mRatBN7.2	16	17,258,160 - 17,274,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	17,258,164 - 17,273,415 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	17,326,841 - 17,342,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	18,457,823 - 18,473,312 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	17,379,766 - 17,395,255 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	18,960,197 - 18,974,942 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	18,959,315 - 18,974,770 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	18,822,741 - 18,837,486 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	17,669,835 - 17,684,440 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	17,668,985 - 17,684,446 (-)	NCBI
Celera	16	17,478,830 - 17,493,434 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

aconitine (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

clothianidin (ISO)

dexamethasone (ISO)

diazinon (ISO)

dibutyl phthalate (EXP)

ethanol (ISO)

formaldehyde (ISO)

gentamycin (EXP)

indometacin (ISO)

lead(0) (ISO)

maneb (ISO)

methyl methanesulfonate (ISO)

paraquat (ISO)

PCB138 (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

propanal (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

Soman (EXP)

titanium dioxide (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to caffeine (IEA,ISO)

endoplasmic reticulum organization (IEA,ISO)

inorganic cation transmembrane transport (ISO)

potassium ion transmembrane transport (IEA,ISO)

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion (IEA,ISO)

regulation of release of sequestered calcium ion into cytosol (ISS)

release of sequestered calcium ion into cytosol by sarcoplasmic reticulum (IEA,ISO)

Cellular Component

nuclear membrane (IEA,ISO,ISS)

sarcoplasmic reticulum (ISO)

sarcoplasmic reticulum membrane (IEA,ISS)

Molecular Function

identical protein binding (IEA,ISO)

metal ion binding (IEA)

potassium channel activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17611541	PMID:18035970	PMID:19056867	PMID:26316108	PMID:31505169

Genomics

Comparative Map Data

Tmem38a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	17,292,215 - 17,307,704 (-)	NCBI		GRCr8
mRatBN7.2	16	17,258,160 - 17,274,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	17,258,164 - 17,273,415 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	17,326,841 - 17,342,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	18,457,823 - 18,473,312 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	17,379,766 - 17,395,255 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	18,960,197 - 18,974,942 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	18,959,315 - 18,974,770 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	18,822,741 - 18,837,486 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	17,669,835 - 17,684,440 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	17,668,985 - 17,684,446 (-)	NCBI
Celera	16	17,478,830 - 17,493,434 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

TMEM38A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	16,661,139 - 16,690,023 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	16,661,139 - 16,690,023 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	16,771,950 - 16,800,834 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	16,632,938 - 16,660,830 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	16,632,937 - 16,660,814	NCBI
Celera	19	16,673,777 - 16,701,673 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	16,340,650 - 16,368,543 (+)	NCBI		HuRef
CHM1_1	19	16,771,437 - 16,799,382 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	16,795,931 - 16,824,815 (+)	NCBI		T2T-CHM13v2.0

Tmem38a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	73,325,033 - 73,341,128 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	73,325,899 - 73,341,126 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	72,571,189 - 72,587,284 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	72,572,055 - 72,587,282 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	75,096,002 - 75,111,183 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	75,501,092 - 75,516,273 (+)	NCBI		MGSCv36	mm8
Celera	8	76,918,441 - 76,933,607 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	35.08	NCBI

Tmem38a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	1,132,111 - 1,144,380 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	1,132,111 - 1,144,335 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMEM38A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	21,532,243 - 21,574,556 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	20,539,413 - 20,581,132 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	16,150,715 - 16,179,256 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	17,129,060 - 17,159,002 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	17,129,842 - 17,159,002 (+)	Ensembl	panpan1.1		panPan2

TMEM38A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	45,876,642 - 45,895,054 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	45,877,524 - 45,894,986 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	45,790,121 - 45,808,540 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	46,363,605 - 46,382,014 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	46,363,604 - 46,382,008 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	45,598,857 - 45,617,268 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	46,009,411 - 46,027,833 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	46,284,762 - 46,303,184 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem38a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	204,416,087 - 204,434,925 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	3,965,203 - 3,984,006 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	3,965,220 - 3,984,120 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM38A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	60,929,049 - 60,960,467 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	60,929,043 - 60,960,527 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	60,517,874 - 60,526,926 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103234112
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	15,169,143 - 15,200,372 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	15,170,033 - 15,200,481 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	4,270,392 - 4,299,557 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem38a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	836,347 - 849,998 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624908	837,753 - 849,972 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem38a
56 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	49
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000064060
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Markers in Region

RH132229

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,258,166 - 17,258,355 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,959,357 - 18,959,545	NCBI	Rnor6.0
Rnor_5.0	16	18,821,901 - 18,822,089	UniSTS	Rnor5.0
RGSC_v3.4	16	17,668,995 - 17,669,183	UniSTS	RGSC3.4
Celera	16	17,477,990 - 17,478,178	UniSTS
RH 3.4 Map	16	178.5	UniSTS
Cytogenetic Map	16	p14	UniSTS

BF405600

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,262,377 - 17,262,556 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,963,707 - 18,963,885	NCBI	Rnor6.0
Rnor_5.0	16	18,826,251 - 18,826,429	UniSTS	Rnor5.0
RGSC_v3.4	16	17,673,205 - 17,673,383	UniSTS	RGSC3.4
Celera	16	17,482,200 - 17,482,378	UniSTS
RH 3.4 Map	16	178.7	UniSTS
Cytogenetic Map	16	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF690436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064060 ⟹ ENSRNOP00000059284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	17,258,164 - 17,273,411 (-)	Ensembl
Rnor_6.0 Ensembl	16	18,959,315 - 18,974,770 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086424 ⟹ ENSRNOP00000073925

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	17,258,166 - 17,273,400 (-)	Ensembl
Rnor_6.0 Ensembl	16	18,959,356 - 18,974,729 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095472 ⟹ ENSRNOP00000085684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	17,258,167 - 17,273,415 (-)	Ensembl

RefSeq Acc Id:

NM_001100175 ⟹ NP_001093645

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	17,292,215 - 17,307,704 (-)	NCBI
mRatBN7.2	16	17,258,164 - 17,273,655 (-)	NCBI
Rnor_6.0	16	18,960,197 - 18,974,942 (-)	NCBI
Rnor_5.0	16	18,822,741 - 18,837,486 (-)	NCBI
RGSC_v3.4	16	17,669,835 - 17,684,440 (-)	RGD
Celera	16	17,478,830 - 17,493,434 (-)	RGD

Sequence:

show sequence

CCTCTGTGCGCTGGATGCAGGGGATAGATCCCTTTTGGCTCAGTTGACCGGGTTCTAGCGTCCC
TGCAGCCCGGTGCCTTGGGCTCCAGGGTGCTAGGCGTCCCCACCGCCCCTCCTCTCCTGGGGGG
CAGGCAGGGGGCGGTGCCTGGCAGTGAGCTAGGTTCATTGGCGAGGGAGCAGTCGCCGGGCAGC
GGGGCGCGGGACACACGGGGCCGCGGAGGCGCCCTCCATCGCCATGGACCTGATATCATCGCTG
AGCCTGGGCGAGCTAGCGCTCAGCTTCTCGCGGGTGCCGCTCTTCCCTGTCTTCGACCTCAGCT
ACTTCATCGTCTCCATCATCTACCTGAAGTATGAGCCAGGGTCTGTGGAGCTGTCCCGGCGTCA
CCCGGTGGCATCCTGGCTGTGCGCCATGCTGCACTGTTTTGGGAGTTACATCCTGGCCGACCTG
CTTCTTGGGGAGCCCATCATTGACTACTTCAGCAACAGCTCCAGTATCCTGCTGGCCTCCGGAG
TGTGGTACTTGATTTTCTTCTGTCCCTTGGACCTCTTCTACAAGTGCGTCTGCTTTCTGCCTGT
AAAACTCATCTTTGTGGCTATGAAGGAGGTGGTGAGGGTCCGAAAGATTGCTGTGGGTATCCAT
CACGCACACCACTACCACCATGGGTGGTTCATCATGATCGCCACCGGATGGGTCAAAGGCTCTG
GCGTTGCCCTTCTGTCCAACTTGGAACAGCTGCTTCGAGGCGTCTGGAAGCCAGAGACCAATGA
GATCCTACACATGTCCTTCCCCACTAAGGCCAGTCTGTATGGAGCCATCCTGTTCACCTTGCAA
CAGACCCGCTGGCTCCCAGTGTCCAAGGCCAGCCTCATCTTCGTCTTCACCATGTTTATGGTGT
CGTGTAAGGTGTTCCTGACAGCCACTCACTCCCATAGTTCTCCATTTGATGTCCTGGAGGGTTA
CATCTGCCCAGTGCTGTTTGGGGCAACTTGGGGAGGCGACCATCACCATGACAACCATGGAGCA
CCACATGGCATGGGGCTAGGCACCCAGCACTCTGGCTTGCCTGCTAAGGCCAAGGAAGAGCTGA
GCGAAGGCTTCAGGAAGAAAAAGACCAAGAAAGCGGATTAGGGTTGGCCCCAGGGATGGATCCA
CTGGGGGCTTGGGAGAAGGATATGAATTCAGAGAAACTCAGAATTTAGGGCATTCAGGGCTGGG
AAACCCCCCTCCCCCCACCAGCCTCAATTTCCCCACCTACAATTTGGAGCCATCAGCAACCCCA
GGGCTGATGTGGGGTTAAATTAATGTGGAGGAGTTTGGTAGGAGTGGAAAACCCTGCCTTCTGC
CAGACTCCTCATCCGGTCACAGGCTTTGGGGGATACACAGTCCAGGCCTAAAGGCTGGTAGGTT
CTTGGTTTTCATTCTGTGTTCTAAATATATCTTGAAACCAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094477 ⟹ XP_038950405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	17,292,215 - 17,307,484 (-)	NCBI
mRatBN7.2	16	17,258,160 - 17,274,204 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001093645	(Get FASTA)	NCBI Sequence Viewer
	XP_038950405	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A6ZIQ8	(Get FASTA)	NCBI Sequence Viewer
	AAI61801	(Get FASTA)	NCBI Sequence Viewer
	ABR68564	(Get FASTA)	NCBI Sequence Viewer
	EDL90852	(Get FASTA)	NCBI Sequence Viewer
	EDL90853	(Get FASTA)	NCBI Sequence Viewer
	EDL90854	(Get FASTA)	NCBI Sequence Viewer
	EDL90855	(Get FASTA)	NCBI Sequence Viewer
	EDL90856	(Get FASTA)	NCBI Sequence Viewer
	EDL90857	(Get FASTA)	NCBI Sequence Viewer
	EDL90858	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059284.1
	ENSRNOP00000073925.1
	ENSRNOP00000085684.1

RefSeq Acc Id:

NP_001093645 ⟸ NM_001100175

- UniProtKB:

A6ZIQ8 (UniProtKB/Swiss-Prot), G3V9T4 (UniProtKB/TrEMBL), A6K9N3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDLISSLSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGSVELSRRHPVASWLCAMLHCFG
SYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVR
KIAVGIHHAHHYHHGWFIMIATGWVKGSGVALLSNLEQLLRGVWKPETNEILHMSFPTKASLYG
AILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDVLEGYICPVLFGATWGGDH
HHDNHGAPHGMGLGTQHSGLPAKAKEELSEGFRKKKTKKAD

hide sequence

Ensembl Acc Id:

ENSRNOP00000073925 ⟸ ENSRNOT00000086424

Ensembl Acc Id:

ENSRNOP00000059284 ⟸ ENSRNOT00000064060

RefSeq Acc Id:	XP_038950405 ⟸ XM_039094477
- Peptide Label:	isoform X1
- UniProtKB:	B1WBL7 (UniProtKB/TrEMBL), A0A0G2K6S5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085684 ⟸ ENSRNOT00000095472

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A6ZIQ8-F1-model_v2	AlphaFold	A6ZIQ8	1-297	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699979

Promoter ID:

EPDNEW_R10501

Type:

initiation region

Name:

Tmem38a_1

Description:

transmembrane protein 38a

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	18,974,794 - 18,974,854	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307901	AgrOrtholog
BioCyc Gene	G2FUF-11895	BioCyc
Ensembl Genes	ENSRNOG00000011912	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064060.3	UniProtKB/TrEMBL
	ENSRNOT00000086424.2	UniProtKB/TrEMBL
	ENSRNOT00000095472.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7128088	IMAGE-MGC_LOAD
InterPro	TRIC_channel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:306327	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187200	IMAGE-MGC_LOAD
NCBI Gene	306327	ENTREZGENE
PANTHER	PTHR12454	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRIMERIC INTRACELLULAR CATION CHANNEL TYPE A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TRIC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tmem38a	PhenoGen
RatGTEx	ENSRNOG00000011912	RatGTEx
UniProt	A0A0G2K6S5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A2V4_RAT	UniProtKB/TrEMBL
	A6K9N3	ENTREZGENE, UniProtKB/TrEMBL
	A6ZIQ8	ENTREZGENE
	B1WBL7	ENTREZGENE, UniProtKB/TrEMBL
	G3V9T4	ENTREZGENE, UniProtKB/TrEMBL
	TM38A_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Tmem38a	transmembrane protein 38a	Tmem38a_predicted	transmembrane protein 38a (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Tmem38a_predicted	transmembrane protein 38a (predicted)	RGD1307901_predicted	similar to RIKEN cDNA 1110001E17 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1307901_predicted	similar to RIKEN cDNA 1110001E17 (predicted)	LOC306327_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC306327_predicted	similar to RIKEN cDNA 1110001E17 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message