Advanced Search (OLGA)

Gene: Rit2 (Ras-like without CAAX 2) Rattus norvegicus

Analyze

Symbol:

Rit2

Name:

Ras-like without CAAX 2

RGD ID:

1307654

Description:

Predicted to enable several functions, including calmodulin binding activity; guanyl ribonucleotide binding activity; and semaphorin receptor binding activity. Involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway; positive regulation of neuron projection development; and regulation of intracellular signal transduction. Predicted to be located in several cellular components, including cell body; dendritic tree; and membrane raft. Predicted to be active in plasma membrane. Biomarker of acute myocardial infarction. Orthologous to human RIT2 (Ras like without CAAX 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GTP-binding protein Rit2; LOC291713; MGC109463; Ras-like without CAAX 1; Rin; Rit1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RIT2 (Ras like without CAAX 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rit2 (Ras-like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rit2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RIT2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RIT2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rit2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RIT2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rit2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rit2 (Ras like without CAAX 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RIT2 (Ras like without CAAX 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rit2 (Ras-like without CAAX 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rit1 (Ras-like without CAAX 1)	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Ric	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	22,839,914 - 23,196,137 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	22,839,915 - 23,269,823 (-)	Ensembl				GRCr8
mRatBN7.2	18	22,565,403 - 22,921,648 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	22,565,404 - 22,921,648 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	22,693,784 - 23,050,032 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	23,464,935 - 23,811,932 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	22,788,747 - 23,144,988 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	23,700,012 - 24,057,917 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	23,700,013 - 24,057,917 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	23,424,106 - 23,780,916 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	23,316,074 - 23,682,927 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	22,336,942 - 22,688,745 (-)	NCBI		Celera
RGSC_v3.1	18	23,342,720 - 23,709,573 (-)	NCBI
Cytogenetic Map	18	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myocardial infarction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP,ISO)

carmustine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

cycloastragenol (EXP)

disodium selenite (ISO)

ethanol (ISO)

fulvestrant (ISO)

genistein (ISO)

maneb (ISO)

methoxychlor (EXP)

paraquat (ISO)

PCB138 (ISO)

progesterone (ISO)

quercetin (ISO)

thiram (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP)

intracellular signal transduction (IEA,ISO)

maintenance of protein location in cell (IEA,ISO)

MAPK cascade (ISO)

negative regulation of neuron projection development (IEA,ISO)

positive regulation of MAPK cascade (IMP)

positive regulation of neuron projection development (IBA,IEA,IGI,IMP,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

Ras protein signal transduction (IBA,IEA,ISO)

regulation of calcium-mediated signaling (IMP)

regulation of Cdc42 protein signal transduction (IEA,ISO)

regulation of endocytosis (IEA,ISO)

regulation of ERK1 and ERK2 cascade (ISO)

signal transduction (IEA)

Cellular Component

cell body (IEA,ISO,ISS)

cytoplasm (IEA,ISO)

dendritic tree (IEA,ISO,ISS)

endomembrane system (IEA)

membrane (IEA)

membrane raft (IEA,ISO)

neuron projection (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS,TAS)

Molecular Function

calmodulin binding (IBA,IEA,ISO,ISS)

chromatin binding (IEA,ISO)

G protein activity (IEA)

GTP binding (IEA,ISO,ISS)

GTPase activity (IBA,IEA,ISO,ISS)

hydrolase activity (IEA)

identical protein binding (ISO)

nucleotide binding (IEA)

protein binding (IPI,ISO)

semaphorin receptor binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Small GTPase Rin induces neurite outgrowth through Rac/Cdc42 and calmodulin in PC12 cells.	Hoshino M and Nakamura S, J Cell Biol. 2003 Dec 8;163(5):1067-76.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	The plasma membrane-associated GTPase Rin interacts with the dopamine transporter and is required for protein kinase C-regulated dopamine transporter trafficking.	Navaroli DM, etal., J Neurosci. 2011 Sep 28;31(39):13758-70. doi: 10.1523/JNEUROSCI.2649-11.2011.
5.	Application quantitative proteomics approach to identify differentially expressed proteins associated with cardiac protection mediated by cycloastragenol in acute myocardial infarction rats.	Ren YS, etal., J Proteomics. 2020 Jun 30;222:103691. doi: 10.1016/j.jprot.2020.103691. Epub 2020 Feb 14.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Rin GTPase couples nerve growth factor signaling to p38 and b-Raf/ERK pathways to promote neuronal differentiation.	Shi GX, etal., J Biol Chem. 2005 Nov 11;280(45):37599-609. Epub 2005 Sep 12.
10.	Pituitary adenylate cyclase-activating polypeptide 38-mediated Rin activation requires Src and contributes to the regulation of HSP27 signaling during neuronal differentiation.	Shi GX, etal., Mol Cell Biol. 2008 Aug;28(16):4940-51. Epub 2008 Jun 9.
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8824319	PMID:8918462	PMID:10545207	PMID:11877426	PMID:12934100	PMID:15489334	PMID:16122393	PMID:17460085	PMID:23805044

Genomics

Comparative Map Data

Rit2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	22,839,914 - 23,196,137 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	22,839,915 - 23,269,823 (-)	Ensembl				GRCr8
mRatBN7.2	18	22,565,403 - 22,921,648 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	22,565,404 - 22,921,648 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	22,693,784 - 23,050,032 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	23,464,935 - 23,811,932 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	22,788,747 - 23,144,988 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	23,700,012 - 24,057,917 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	23,700,013 - 24,057,917 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	23,424,106 - 23,780,916 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	23,316,074 - 23,682,927 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	22,336,942 - 22,688,745 (-)	NCBI		Celera
RGSC_v3.1	18	23,342,720 - 23,709,573 (-)	NCBI
Cytogenetic Map	18	p12	NCBI

RIT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	42,743,227 - 43,115,685 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	42,743,218 - 43,115,719 (-)	Ensembl			hg38	GRCh38
GRCh37	18	40,323,192 - 40,695,650 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	38,577,190 - 38,949,655 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	38,577,190 - 38,949,655	NCBI
Celera	18	37,131,398 - 37,503,903 (-)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI
HuRef	18	37,181,822 - 37,554,154 (-)	NCBI		HuRef
CHM1_1	18	40,246,782 - 40,622,669 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	42,935,007 - 43,307,454 (-)	NCBI		T2T-CHM13v2.0

Rit2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	31,107,367 - 31,450,181 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	31,106,542 - 31,450,343 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	30,974,314 - 31,317,128 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	30,973,489 - 31,317,290 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	31,133,968 - 31,476,782 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	31,117,324 - 31,460,138 (-)	NCBI		MGSCv36	mm8
Celera	18	31,458,250 - 31,802,813 (-)	NCBI		Celera
Cytogenetic Map	18	B1	NCBI
cM Map	18	17.69	NCBI

Rit2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	28,737,575 - 29,078,777 (-)	Ensembl
ChiLan1.0	NW_004955402	28,737,882 - 29,137,006 (-)	NCBI	ChiLan1.0	ChiLan1.0

RIT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	60,151,407 - 60,524,443 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	45,843,999 - 46,217,037 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	36,008,302 - 36,381,259 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	39,558,082 - 39,930,386 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	39,557,814 - 39,930,393 (-)	Ensembl			panPan2	panpan1.1

RIT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	47,597,746 - 48,064,202 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	47,597,731 - 48,081,048 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	47,014,511 - 47,480,592 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	47,553,975 - 48,020,921 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	47,553,798 - 48,020,921 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	47,256,327 - 47,722,627 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	47,292,605 - 47,760,797 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	47,581,850 - 48,049,236 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rit2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	43,818,361 - 44,207,613 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936517	3,145,598 - 3,480,781 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936517	3,145,761 - 3,535,014 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RIT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	37,751,946 - 38,132,453 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666050	12,181,664 - 12,576,855 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rit2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624779	17,128,075 - 17,467,817 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624779	17,128,640 - 17,467,505 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rit2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	12,777,262 - 12,945,848 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rit2
2445 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	142
Count of miRNA genes:	103
Interacting mature miRNAs:	132
Transcripts:	ENSRNOT00000023874
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301410	Bp317	Blood pressure QTL 317		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	12219237	26822399	Rat
2301409	Cm70	Cardiac mass QTL 70		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	18	7065728	52065728	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	22015562	61600538	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	15642280	31610627	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	12216684	31644508	Rat
12904716	Am21	Aortic mass QTL 21		0.005	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	7065728	52065728	Rat
8552968	Pigfal19	Plasma insulin-like growth factor 1 level QTL 19	11.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	18	1	26032889	Rat
12904714	Cm131	Cardiac mass QTL 131		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	7065728	52065728	Rat
12904715	Cm132	Cardiac mass QTL 132		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	7065728	52065728	Rat
1331781	Scl28	Serum cholesterol level QTL 28	3.995		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	1	25071266	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	15226101	42690662	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	31610627	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5460455	42690191	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	31610627	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	12216684	31644508	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	31610627	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	44930869	Rat
12904680	Bw189	Body weight QTL 189		0.019	body mass (VT:0001259)	body weight (CMO:0000012)	18	12219237	26822399	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	12066482	57066482	Rat
1641910	Colcr3	Colorectal carcinoma resistance QTL 3	5.02	0.000007	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	1	25022372	Rat
12904693	Am20	Aortic mass QTL 20		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	12219237	26822399	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
12904695	Kidm73	Kidney mass QTL 73		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	12219237	26822399	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	3811902	30809809	Rat
12904689	Cm128	Cardiac mass QTL 128		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	12219237	26822399	Rat
12904690	Cm129	Cardiac mass QTL 129		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	12219237	26822399	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34566578	Rat
12904691	Cm130	Cardiac mass QTL 130		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	12219237	26822399	Rat
9590248	Scort10	Serum corticosterone level QTL 10	19.71	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	1	26032889	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4482648	49482648	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	54490981	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
11565454	Kidm59	Kidney mass QTL 59		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	7065728	52065728	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34566578	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	4307354	49307354	Rat

Markers in Region

RH127718

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	22,565,527 - 22,565,743 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	23,700,137 - 23,700,352	NCBI	Rnor6.0
Rnor_5.0	18	23,424,231 - 23,424,446	UniSTS	Rnor5.0
RGSC_v3.4	18	23,316,199 - 23,316,414	UniSTS	RGSC3.4
Celera	18	22,337,067 - 22,337,282	UniSTS
RH 3.4 Map	18	264.4	UniSTS
Cytogenetic Map	18	p12	UniSTS

RH140372

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	22,566,242 - 22,566,401 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	23,700,852 - 23,701,010	NCBI	Rnor6.0
Rnor_5.0	18	23,424,946 - 23,425,104	UniSTS	Rnor5.0
RGSC_v3.4	18	23,316,915 - 23,317,073	UniSTS	RGSC3.4
Celera	18	22,337,782 - 22,337,940	UniSTS
RH 3.4 Map	18	265.3	UniSTS
Cytogenetic Map	18	p12	UniSTS

RH28698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	22,566,062 - 22,566,135 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	23,700,672 - 23,700,744	NCBI	Rnor6.0
Rnor_5.0	18	23,424,766 - 23,424,838	UniSTS	Rnor5.0
RGSC_v3.4	18	23,316,735 - 23,316,807	UniSTS	RGSC3.4
Celera	18	22,337,602 - 22,337,674	UniSTS
Cytogenetic Map	18	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	8	26	147	49	43	20	41	20	4	171	89	2	131	43	90	23	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023874 ⟹ ENSRNOP00000023871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	22,839,915 - 23,196,137 (-)	Ensembl
mRatBN7.2 Ensembl	18	22,565,404 - 22,921,648 (-)	Ensembl
Rnor_6.0 Ensembl	18	23,700,013 - 24,057,917 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103385 ⟹ ENSRNOP00000077118

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	23,074,512 - 23,196,137 (-)	Ensembl
mRatBN7.2 Ensembl	18	22,800,013 - 22,921,648 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135775 ⟹ ENSRNOP00000102955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	22,839,915 - 23,223,289 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000150223 ⟹ ENSRNOP00000111393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	22,839,915 - 23,269,823 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000173757 ⟹ ENSRNOP00000112812

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	22,839,915 - 23,222,602 (-)	Ensembl

RefSeq Acc Id:

NM_001013060 ⟹ NP_001013078

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	22,839,914 - 23,196,137 (-)	NCBI
mRatBN7.2	18	22,565,403 - 22,921,648 (-)	NCBI
Rnor_6.0	18	23,700,012 - 24,057,917 (-)	NCBI
Rnor_5.0	18	23,424,106 - 23,780,916 (-)	NCBI
RGSC_v3.4	18	23,316,074 - 23,682,927 (-)	RGD
Celera	18	22,336,942 - 22,688,745 (-)	RGD

Sequence:

show sequence

GCAATGGAGAAATAAAACGCAGAGGGAAGGGGAAAAAATCAGAATGAGCAAGTGAGATCAGTGG
AGATGTGAAACAGTGAAGGATCAGAGGGAGGGGGAGGCAAAGCCAGATTTTTATTGGAAGCAAT
TGAAGTGGTTGCTATGAGACCCGCTCCAGCAGAGGACCAGCAGGCAGCCTGTCGCTGATGGTTC
TTGTCGTGCACCAAAGCTTTCCTTTGACACAGTTTTAGAGTTGTTTACTGTCTGAGCAAGCACC
TGACACGGTGACTTTTTTCTTCCTTTTTTTCCTCCTCGGGTCCCCCGAGAAAAATGGAAGCAGA
AAACGAAGCCCACTGCTGCCCTGGCAGCTCATCAGGCGGGTCCAGAGAGTACAAGGTGGTAATG
CTGGGCGCAGGGGGCGTTGGTAAAAGCGCAGTCACAATGCAGTTTATAAGCCACCAGTTCCCGG
ACTATCATGACCCCACAATCGAAGATGCTTATAAAACCCAGGTGAGGATTGACAACGAGCCTGC
TTACTTAGACATCTTGGACACTGCCGGTCAGGCAGAGTTCACAGCCATGAGGGAGCAGTACATG
CGTGGGGGAGAGGGCTTCATCATCTGCTATTCTGTCACTGACCGCCAGTCATTCCAGGAGGCTG
CCAAGTTCAAGGAGCTGATTTTCCAGGTCCGTCACACCTATGAAATTCCCCTCGTGCTAGTGGG
TAACAAGATTGACTTGGAGCAGTTCCGTCAGGTTTCTACAGAAGAAGGCATGACTCTTGCTCGA
GACTACAACTGTGCCTTCTTTGAGACCTCTGCAGCCCTTCGATTCGGTATTGATGATGCTTTTC
AAGGCTTAGTGAGAGAAATACGCAGGAAGGAATCCATGCTGTCCTTGGTGGAAAGGAAATTAAA
GAGGAAGGACAGCCTGTGGAAGAAGATAAAAGCCTCGCTGAAGAAGAAGCGAGAAAACATGATA
TGAGGCCTTGCTTCTGCATCCTTCGTGTCTGTCTTTGTGGGCTTTATCATCCAGACAACTGTTC
ATATCTCCATCTTCTCTCTCTACCCACCTCTCCCTGTCTTTCTGTCTGTCTGTCTCTCAACATC
TAACTGCAGGCAGAAATTAGACTTCTTTAACTGTATGTCTTGAGGTAGTTTTATTTTGCCTTTA
ACAGCTGGGTAGATTTTGTCAATCAGCTGGATAGTGCTTTACAGATTTCACAATATATTACCAA
ATAAAATTAACATTCCAATTGCCTCATTTTCCTGTAAAGAGTAGCTTCATTTTGTATGCTGTCT
GGCTATAAAGAAAATATGCAAACTTGTAACTGGGATGATAAAAGGCTTAGGGGATCTGCTTTCG
CCTGATAACCCTGGTTGTTTGCATTTCACAAATCTGTAAATAATGAAGAGGCTGAAATAGTTTA
AAGGAAAAAAGAAAACAGTCCTGTGTCTTCTCTTAAGTGGAAGAGTCTTGCTATTTCTTCTCGA
GTCCTCTACAGATGAGCATTAGAGAAATTATTGATAATAAGAACTTAGTTTGTGTTGTAACAAA
AATTACGTGTCCATATTCACAGTGCGCAGCCTTTCATACACTTCTATAGAAGTATCACAGTGGA
GTTACTGTGCTGAAAGTATGTTATCTGTTGTAGAGAGAAGCAATGCTATGAACTTGGTGGTATG
TATGCCCAAGAAAGGACCCTTTGCCCCTCTCTGTGAATCTTTCTTAGAATTGCTTCACCTGCAC
AGTGGCCGTCTGTCTGCAGGGATGCGGCCTCCACATACTAAATGTTCTCTTTATATTAGTAAAT
TCCCTGTCTCTATTTCAATGAAGTATTACAAGAAGCTGACATCAGAGATGTTGTTGTTATTTGT
CTTATAATGGTTCATTGTGTAAAATAAAACCTCTCGTTCAGCCAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013078	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91382	(Get FASTA)	NCBI Sequence Viewer
	EDL76164	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023871
	ENSRNOP00000023871.4
GenBank Protein	Q5BJQ5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013078 ⟸ NM_001013060

- UniProtKB:

Q5BJQ5 (UniProtKB/Swiss-Prot), A6J2N2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAENEAHCCPGSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRID
NEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPL
VLVGNKIDLEQFRQVSTEEGMTLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVE
RKLKRKDSLWKKIKASLKKKRENMI

hide sequence

Ensembl Acc Id:

ENSRNOP00000023871 ⟸ ENSRNOT00000023874

Ensembl Acc Id:

ENSRNOP00000077118 ⟸ ENSRNOT00000103385

Ensembl Acc Id:

ENSRNOP00000102955 ⟸ ENSRNOT00000135775

Ensembl Acc Id:

ENSRNOP00000112812 ⟸ ENSRNOT00000173757

Ensembl Acc Id:

ENSRNOP00000111393 ⟸ ENSRNOT00000150223

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJQ5-F1-model_v2	AlphaFold	Q5BJQ5	1-217	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307654	AgrOrtholog
BioCyc Gene	G2FUF-8071	BioCyc
Ensembl Genes	ENSRNOG00000017568	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023874	ENTREZGENE
	ENSRNOT00000023874.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7320994	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
	Small_GTPase_Ras-type	UniProtKB/Swiss-Prot
KEGG Report	rno:291713	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109463	IMAGE-MGC_LOAD
NCBI Gene	291713	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rit2	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017568	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y0R5_RAT	UniProtKB/TrEMBL
	A0ABK0L2H3_RAT	UniProtKB/TrEMBL
	A0ABK0M976_RAT	UniProtKB/TrEMBL
	A0ABK0M997_RAT	UniProtKB/TrEMBL
	A6J2N2	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJQ5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-04-05	Rit2	Ras-like without CAAX 2	Rit1	Ras-like without CAAX 1	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-12-06	Rit1	Ras-like without CAAX 1	Rit1_predicted	Ras-like without CAAX 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rit1_predicted	Ras-like without CAAX 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message