Advanced Search (OLGA)

Gene: Bbs1 (Bardet-Biedl syndrome 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Bbs1

Name:

Bardet-Biedl syndrome 1

RGD ID:

1307581

Description:

Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity; phosphoprotein binding activity; and signaling receptor binding activity. Predicted to be involved in several processes, including non-motile cilium assembly; photoreceptor cell maintenance; and regulation of cilium beat frequency involved in ciliary motility. Predicted to act upstream of or within several processes, including Golgi to plasma membrane protein transport; nervous system development; and olfactory behavior. Predicted to be located in centriolar satellite; ciliary membrane; and motile cilium. Predicted to be part of BBSome. Predicted to be active in axoneme and centrosome. Human ortholog(s) of this gene implicated in Bardet-Biedl syndrome and Bardet-Biedl syndrome 1. Orthologous to human BBS1 (Bardet-Biedl syndrome 1); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Bardet-Biedl syndrome 1 homolog; Bardet-Biedl syndrome 1 homolog (human); Bardet-Biedl syndrome 1 protein; LOC309156

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BBS1 (Bardet-Biedl syndrome 1)	HGNC	Ensembl, Inparanoid, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bbs1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bbs1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BBS1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BBS1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bbs1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BBS1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BBS1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bbs1 (Bardet-Biedl syndrome 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KCNMB1 (potassium calcium-activated channel subfamily M regulatory beta subunit 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	BBS1 (Bardet-Biedl syndrome 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Bbs1 (Bardet-Biedl syndrome 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bbs1 (Bardet-Biedl syndrome 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	BBS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bbs-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bbs1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Arrd2

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	211,614,195 - 211,633,504 (-)	NCBI		GRCr8
mRatBN7.2	1	202,184,812 - 202,204,118 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	202,186,125 - 202,204,086 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	210,539,190 - 210,557,170 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,631,564 - 217,649,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	210,322,591 - 210,340,523 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	220,146,084 - 220,165,545 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	220,147,327 - 220,165,678 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	227,078,590 - 227,096,525 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	207,503,399 - 207,521,683 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,658,767 - 207,675,153 (-)	NCBI
Celera	1	199,725,764 - 199,743,588 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	Bardet-Biedl syndrome		ISO	BBS1 (Homo sapiens)	1579969	DNA:mutations: :multiple (human)	RGD
Bbs1	Rat	hyperinsulinism		ISO	Bbs1 (Mus musculus)	243065268		RGD
Bbs1	Rat	obesity	no_association	ISO	BBS1 (Homo sapiens)	1601314	DNA:mutation: :p.M390R (human)	RGD
Bbs1	Rat	obesity		ISO	Bbs1 (Mus musculus)	243065268		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	Aicardi-Goutieres Syndrome 3		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 3	ClinVar	PMID:28492532
Bbs1	Rat	Bardet-Biedl syndrome		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:10564830 more ...
Bbs1	Rat	Bardet-Biedl syndrome 1		ISO	BBS1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10564830 more ...
Bbs1	Rat	Bardet-Biedl Syndrome 1/7, Digenic		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome 1/7 and digenic	ClinVar	PMID:12567324 more ...
Bbs1	Rat	congenital muscular dystrophy-dystroglycanopathy type A13		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Muscular dystrophy-dystroglycanopathy (congenital with brain and eye anomalies), type A13	ClinVar	PMID:22219654 and PMID:28492532
Bbs1	Rat	fundus dystrophy		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinal dystrophy	ClinVar	PMID:12118255 more ...
Bbs1	Rat	genetic disease		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:12118255 more ...
Bbs1	Rat	glycogen storage disease V		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease and type V	ClinVar	PMID:12118255 more ...
Bbs1	Rat	immunodeficiency 90		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Infections more ...	ClinVar	PMID:28492532
Bbs1	Rat	intellectual disability		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Bbs1	Rat	retinitis pigmentosa		ISO	BBS1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:12118255 more ...
Bbs1	Rat	retinitis pigmentosa		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinitis pigmentosa	ClinVar	PMID:12118255 more ...
Bbs1	Rat	Usher syndrome		ISO	BBS1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Usher syndrome	ClinVar	PMID:12118255 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	Bardet-Biedl syndrome 1		ISO	BBS1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	Bardet-Biedl syndrome 1		ISS	Bbs1 (Mus musculus)	13592920	OMIM:209900	MouseDO
Bbs1	Rat	obesity		ISS	Bbs1 (Mus musculus)	13592920	OMIM:601665	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	Bardet-Biedl syndrome 1		ISO	BBS1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Bbs1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BBS1 mRNA	CTD	PMID:17942748
Bbs1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Bbs1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BBS1 mRNA	CTD	PMID:17942748
Bbs1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BBS1 mRNA	CTD	PMID:28628672
Bbs1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Bbs1 (Mus musculus)	6480464	Fenretinide results in increased expression of BBS1 mRNA	CTD	PMID:28973697
Bbs1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of BBS1 mRNA	CTD	PMID:24780913
Bbs1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of BBS1 mRNA	CTD	PMID:28959563
Bbs1	Rat	acrylamide	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	Acrylamide results in decreased expression of BBS1 mRNA	CTD	PMID:32763439
Bbs1	Rat	acrylamide	increases expression	ISO	Bbs1 (Mus musculus)	6480464	Acrylamide results in increased expression of BBS1 mRNA	CTD	PMID:30807115
Bbs1	Rat	aflatoxin B1	increases expression	ISO	Bbs1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of BBS1 mRNA	CTD	PMID:19770486
Bbs1	Rat	aflatoxin B1	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of BBS1 mRNA	CTD	PMID:21641981
Bbs1	Rat	atrazine	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	Atrazine results in decreased expression of BBS1 mRNA	CTD	PMID:22378314
Bbs1	Rat	benzo[a]pyrene	affects methylation	ISO	BBS1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of BBS1 promoter	CTD	PMID:27901495
Bbs1	Rat	beta-lapachone	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of BBS1 mRNA	CTD	PMID:38218311
Bbs1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Bbs1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of BBS1 mRNA	CTD	PMID:34319233
Bbs1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of BBS1 mRNA	CTD	PMID:25181051
Bbs1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BBS1 mRNA	CTD	PMID:30816183 more ...
Bbs1	Rat	bisphenol F	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BBS1 mRNA	CTD	PMID:28628672
Bbs1	Rat	butanal	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of BBS1 mRNA	CTD	PMID:26079696
Bbs1	Rat	C60 fullerene	increases expression	EXP		6480464	fullerene C60 results in increased expression of BBS1 mRNA	CTD	PMID:19167457
Bbs1	Rat	cadmium dichloride	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of BBS1 protein	CTD	PMID:24527689
Bbs1	Rat	carbon nanotube	decreases expression	ISO	Bbs1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Bbs1	Rat	chlorpyrifos	decreases expression	ISO	Bbs1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of BBS1 mRNA	CTD	PMID:37019170
Bbs1	Rat	cisplatin	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of BBS1 mRNA	CTD	PMID:27392435
Bbs1	Rat	cisplatin	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Cisplatin results in increased expression of BBS1 mRNA	CTD	PMID:27392435
Bbs1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of BBS1 mRNA	CTD	PMID:24386269
Bbs1	Rat	copper(II) sulfate	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of BBS1 mRNA	CTD	PMID:19549813
Bbs1	Rat	coumestrol	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[Coumestrol co-treated with resveratrol] results in decreased expression of BBS1 mRNA	CTD	PMID:19167446
Bbs1	Rat	cyclosporin A	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of BBS1 mRNA	CTD	PMID:25562108
Bbs1	Rat	dexamethasone	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BBS1 mRNA	CTD	PMID:28628672
Bbs1	Rat	dicrotophos	increases expression	ISO	BBS1 (Homo sapiens)	6480464	dicrotophos results in increased expression of BBS1 mRNA	CTD	PMID:28302478
Bbs1	Rat	doxorubicin	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of BBS1 mRNA	CTD	PMID:29803840
Bbs1	Rat	ethyl methanesulfonate	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of BBS1 mRNA	CTD	PMID:23649840
Bbs1	Rat	folic acid	decreases expression	ISO	Bbs1 (Mus musculus)	6480464	Folic Acid results in decreased expression of BBS1 mRNA	CTD	PMID:25629700
Bbs1	Rat	formaldehyde	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Formaldehyde results in increased expression of BBS1 mRNA	CTD	PMID:23649840
Bbs1	Rat	indometacin	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of BBS1 mRNA	CTD	PMID:28628672
Bbs1	Rat	methyl methanesulfonate	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of BBS1 mRNA	CTD	PMID:23649840
Bbs1	Rat	methylmercury chloride	decreases expression	ISO	BBS1 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of BBS1 mRNA	CTD	PMID:28001369
Bbs1	Rat	ozone	multiple interactions	ISO	Bbs1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of BBS1 mRNA	CTD	PMID:27106289
Bbs1	Rat	paracetamol	increases expression	ISO	BBS1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of BBS1 mRNA	CTD	PMID:26690555
Bbs1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of BBS1 mRNA	CTD	PMID:33387578
Bbs1	Rat	resveratrol	multiple interactions	ISO	BBS1 (Homo sapiens)	6480464	[Coumestrol co-treated with resveratrol] results in decreased expression of BBS1 mRNA	CTD	PMID:19167446
Bbs1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of BBS1 mRNA	CTD	PMID:34492290

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	adult behavior	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	adult behavior	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	biological_process		ND		1598407	02/2007: no relevant rat data	RGD
Bbs1	Rat	brain morphogenesis	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	brain morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cartilage development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:19195025	RGD	PMID:19195025
Bbs1	Rat	cartilage development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cerebral cortex development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cerebral cortex development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	cilium assembly	involved_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:17574030	RGD	PMID:17574030
Bbs1	Rat	cilium assembly	involved_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cilium assembly	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602 and PMID:27979967	RGD	PMID:18032602 and PMID:27979967
Bbs1	Rat	cilium assembly	involved_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cilium assembly	involved_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:18299575	RGD	PMID:18299575
Bbs1	Rat	dendrite development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	dendrite development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3055491 PMID:15322545	RGD	PMID:15322545
Bbs1	Rat	fat cell differentiation	involved_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	fat cell differentiation	involved_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:17379567	RGD	PMID:17379567
Bbs1	Rat	fertilization	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	fertilization	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	Golgi to plasma membrane protein transport	acts_upstream_of_or_within	ISO	BBS1 (Homo sapiens)	1624291	PMID:19150989	RGD	PMID:19150989
Bbs1	Rat	Golgi to plasma membrane protein transport	acts_upstream_of_or_within	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	hippocampus development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	hippocampus development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	hormone metabolic process	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	hormone metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	lipid metabolic process	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	lipid metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	microtubule cytoskeleton organization	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	microtubule cytoskeleton organization	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3055491 PMID:15322545	RGD	PMID:15322545
Bbs1	Rat	neural precursor cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	neural precursor cell proliferation	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:23160237	RGD	PMID:23160237
Bbs1	Rat	neuron migration	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3055491 PMID:21471969	RGD	PMID:21471969
Bbs1	Rat	neuron migration	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	non-motile cilium assembly	involved_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:17980398	RGD	PMID:17980398
Bbs1	Rat	non-motile cilium assembly	involved_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	non-motile cilium assembly	involved_in	IBA	MGI:1277215 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	non-motile cilium assembly	involved_in	IEA	InterPro:IPR028784	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bbs1	Rat	non-motile cilium assembly	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	non-motile cilium assembly	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:2135272 more ...	RGD	PMID:15322545 more ...
Bbs1	Rat	olfactory behavior	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	olfactory behavior	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	photoreceptor cell maintenance	involved_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:17980398	RGD	PMID:17980398
Bbs1	Rat	photoreceptor cell maintenance	involved_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	photoreceptor cell morphogenesis	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	photoreceptor cell morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	protein localization	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:22228099 and PMID:31302159	RGD	PMID:22228099 and PMID:31302159
Bbs1	Rat	protein localization	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	protein localization to cilium	involved_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:23943788	RGD	PMID:23943788
Bbs1	Rat	protein localization to cilium	involved_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	protein localization to cilium	involved_in	IBA	PANTHER:PTN000466746 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	regulation of cilium beat frequency involved in ciliary motility	involved_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:18299575	RGD	PMID:18299575
Bbs1	Rat	regulation of cilium beat frequency involved in ciliary motility	involved_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	response to endoplasmic reticulum stress	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	PMID:31302159	RGD	PMID:31302159
Bbs1	Rat	response to endoplasmic reticulum stress	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	retina development in camera-type eye	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	retina development in camera-type eye	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	PMID:31302159	RGD	PMID:31302159
Bbs1	Rat	retina homeostasis	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3055491 PMID:15322545	RGD	PMID:15322545
Bbs1	Rat	retina homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	sensory perception of smell	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3055491 PMID:15322545	RGD	PMID:15322545
Bbs1	Rat	sensory perception of smell	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	striatum development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 PMID:18032602	RGD	PMID:18032602
Bbs1	Rat	striatum development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	ventricular system development	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	ventricular system development	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	MGI:3767672 more ...	RGD	PMID:23160237
Bbs1	Rat	visual perception	acts_upstream_of_or_within	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	visual perception	acts_upstream_of_or_within	ISO	Bbs1 (Mus musculus)	1624291	PMID:38155679	RGD	PMID:38155679

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	axoneme	is_active_in	IBA	PANTHER:PTN000466746 and WB:WBGene00000241	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	BBSome	part_of	ISO	BBS1 (Homo sapiens)	1624291	PMID:17574030 more ...	RGD	PMID:17574030 more ...
Bbs1	Rat	BBSome	part_of	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	BBSome	part_of	ISO	Bbs1 (Mus musculus)	1624291	PMID:20080638 more ...	RGD	PMID:20080638 more ...
Bbs1	Rat	BBSome	part_of	IBA	MGI:1277215 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	BBSome	part_of	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	BBSome	part_of	IEA	InterPro:IPR028784	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bbs1	Rat	centriolar satellite	located_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	centriolar satellite	located_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:27979967	RGD	PMID:27979967
Bbs1	Rat	centrosome	located_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:18762586	RGD	PMID:18762586
Bbs1	Rat	centrosome	located_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	centrosome	located_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	centrosome	located_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:21471969	RGD	PMID:21471969
Bbs1	Rat	centrosome	is_active_in	IBA	MGI:1277215 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	ciliary membrane	located_in	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	ciliary membrane	located_in	ISO	BBS1 (Homo sapiens)	1624291	PMID:19081074	RGD	PMID:19081074
Bbs1	Rat	cilium	located_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	cilium	located_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:27979967	RGD	PMID:27979967
Bbs1	Rat	motile cilium	located_in	ISO	Bbs1 (Mus musculus)	1624291	PMID:18299575	RGD	PMID:18299575
Bbs1	Rat	motile cilium	located_in	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bbs1	Rat	patched binding	enables	ISO	BBS1 (Homo sapiens)	1624291	UniProtKB:Q13635 and PMID:22228099	RGD	PMID:22228099
Bbs1	Rat	patched binding	enables	IBA	PANTHER:PTN000466746 and UniProtKB:Q8NFJ9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bbs1	Rat	patched binding	enables	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	phosphoprotein binding	enables	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	phosphoprotein binding	enables	ISO	Bbs1 (Mus musculus)	1624291	PR:Q811T9-1 PMID:21471969	RGD	PMID:21471969
Bbs1	Rat	protein binding	enables	ISO	BBS1 (Homo sapiens)	1624291	UniProtKB:P05062 more ...	RGD	PMID:16327777 more ...
Bbs1	Rat	protein binding	enables	ISO	Bbs1 (Mus musculus)	1624291	PR:Q8BMD2 more ...	RGD	PMID:17574030 more ...
Bbs1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	ISO	BBS1 (Homo sapiens)	1624291	UniProtKB:Q99496 and PMID:22302990	RGD	PMID:22302990
Bbs1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	signaling receptor binding	enables	ISO	Bbs1 (Mus musculus)	1624291	PR:P48356 more ...	RGD	PMID:19150989
Bbs1	Rat	signaling receptor binding	enables	IEA	UniProtKB:Q3V3N7 and ensembl:ENSMUSP00000055321	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	smoothened binding	enables	ISO	BBS1 (Homo sapiens)	1624291	UniProtKB:Q99835 and PMID:22228099	RGD	PMID:22228099
Bbs1	Rat	smoothened binding	enables	IEA	UniProtKB:Q8NFJ9 and ensembl:ENSP00000317469	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bbs1	Rat	smoothened binding	enables	IBA	PANTHER:PTN000466746 and UniProtKB:Q8NFJ9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Bardet-Biedl syndrome 1 genotype and obesity in the Newfoundland population.	Fan Y, etal., Int J Obes Relat Metab Disord. 2004 May;28(5):680-4.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Evaluation of complex inheritance involving the most common Bardet-Biedl syndrome locus (BBS1).	Mykytyn K, etal., Am J Hum Genet. 2003 Feb;72(2):429-37. Epub 2003 Jan 10.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	BBSome ablation in SF1 neurons causes obesity without comorbidities.	Rouabhi M, etal., Mol Metab. 2021 Jun;48:101211. doi: 10.1016/j.molmet.2021.101211. Epub 2021 Mar 13.

PMID:15322545	PMID:16170314	PMID:17379567	PMID:17574030	PMID:17980398	PMID:18032602	PMID:18299575	PMID:18762586	PMID:19150989	PMID:19195025	PMID:20080638	PMID:21471969
PMID:22072986	PMID:22228099	PMID:22302990	PMID:22500027	PMID:23160237	PMID:23943788	PMID:24550735	PMID:27979967

Bbs1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	211,614,195 - 211,633,504 (-)	NCBI		GRCr8
mRatBN7.2	1	202,184,812 - 202,204,118 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	202,186,125 - 202,204,086 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	210,539,190 - 210,557,170 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	217,631,564 - 217,649,496 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	210,322,591 - 210,340,523 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	220,146,084 - 220,165,545 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	220,147,327 - 220,165,678 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	227,078,590 - 227,096,525 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	207,503,399 - 207,521,683 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	207,658,767 - 207,675,153 (-)	NCBI
Celera	1	199,725,764 - 199,743,588 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

BBS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	66,510,635 - 66,533,598 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	66,510,606 - 66,533,613 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	66,278,106 - 66,301,069 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	66,034,695 - 66,057,660 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	66,034,694 - 66,057,660	NCBI
Celera	11	63,598,354 - 63,621,361 (+)	NCBI		Celera
Cytogenetic Map	11	q13.2	NCBI
HuRef	11	62,606,029 - 62,628,992 (+)	NCBI		HuRef
CHM1_1	11	66,161,845 - 66,184,809 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	66,506,874 - 66,529,839 (+)	NCBI		T2T-CHM13v2.0

Bbs1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	4,936,906 - 4,956,681 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	4,936,906 - 4,956,656 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	4,886,878 - 4,906,653 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	4,886,878 - 4,906,628 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	4,886,882 - 4,906,627 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	4,889,158 - 4,906,612 (-)	NCBI		MGSCv36	mm8
Celera	19	4,757,796 - 4,779,714 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	4.14	NCBI

Bbs1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	18,825,756 - 18,844,036 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	18,825,756 - 18,843,820 (-)	NCBI	ChiLan1.0	ChiLan1.0

BBS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	67,736,682 - 67,760,911 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	68,779,386 - 68,803,756 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	61,868,257 - 61,892,473 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	65,192,346 - 65,216,274 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	65,192,355 - 65,216,274 (+)	Ensembl	panpan1.1		panPan2

BBS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	50,816,126 - 50,835,354 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	49,426,815 - 49,443,963 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	51,854,538 - 51,873,747 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	51,853,428 - 51,873,589 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	50,955,485 - 50,974,765 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	50,531,013 - 50,548,161 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	51,320,949 - 51,338,319 (-)	NCBI		UU_Cfam_GSD_1.0

Bbs1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	6,607,347 - 6,634,045 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	3,059,148 - 3,076,299 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	3,059,274 - 3,076,853 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BBS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	5,886,990 - 5,906,388 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	5,886,989 - 5,906,468 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	4,963,170 - 4,982,613 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BBS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	7,737,887 - 7,765,022 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	7,737,578 - 7,764,732 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	105,022,016 - 105,048,815 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bbs1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	19,875,535 - 19,893,694 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	19,875,597 - 19,893,652 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Bbs1
108 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	523
Count of miRNA genes:	256
Interacting mature miRNAs:	326
Transcripts:	ENSRNOT00000026915
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

RH129849

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	202,186,240 - 202,186,437 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	220,147,683 - 220,147,879	NCBI	Rnor6.0
Rnor_5.0	1	227,078,681 - 227,078,877	UniSTS	Rnor5.0
RGSC_v3.4	1	207,503,490 - 207,503,686	UniSTS	RGSC3.4
Celera	1	199,725,855 - 199,726,051	UniSTS
RH 3.4 Map	1	1555.9	UniSTS
Cytogenetic Map	1	q43	UniSTS

RH140927

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	227,097,314 - 227,097,513	NCBI	Rnor5.0
Rnor_5.0	9	35,130,602 - 35,130,801	NCBI	Rnor5.0
RGSC_v3.4	3	138,288,501 - 138,288,699	UniSTS	RGSC3.4
RGSC_v3.4	1	207,522,473 - 207,522,671	UniSTS	RGSC3.4
Celera	9	30,011,590 - 30,011,788	UniSTS
Celera	1	199,744,378 - 199,744,576	UniSTS
Cytogenetic Map	1	q43	UniSTS
Cytogenetic Map	3	q41	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008760137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026915 ⟹ ENSRNOP00000026915

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,186,125 - 202,204,067 (-)	Ensembl
Rnor_6.0 Ensembl	1	220,147,327 - 220,165,678 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097583 ⟹ ENSRNOP00000085404

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,186,125 - 202,204,067 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104874 ⟹ ENSRNOP00000087914

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,186,125 - 202,204,067 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110110 ⟹ ENSRNOP00000087522

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,188,352 - 202,204,086 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111822 ⟹ ENSRNOP00000082124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	202,187,158 - 202,204,074 (-)	Ensembl

RefSeq Acc Id:

NM_001107569 ⟹ NP_001101039

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	211,615,533 - 211,633,468 (-)	NCBI
mRatBN7.2	1	202,186,150 - 202,204,086 (-)	NCBI
Rnor_6.0	1	220,147,592 - 220,165,527 (-)	NCBI
Rnor_5.0	1	227,078,590 - 227,096,525 (-)	NCBI
RGSC_v3.4	1	207,503,399 - 207,521,683 (-)	RGD
Celera	1	199,725,764 - 199,743,588 (-)	RGD

Sequence:

show sequence

ACGGCTGGCTGAGCTGGTTGCCAAGACGACGCCTGGGAAGATGGCTGCGACGACGTCTTCACCGGATTCTGACAGCGGGCGAGCTGAGAGCAACGAAGCCAATTCGAAATGGCTGGATGCACACTACG
ACCCCATGGCCAACATCCATACCTTCTCCTCCTGCCTGGCACTGGCAGATTTGCATGGCGACGGGGAGTACAAGCTGGTGGTGGGAGACCTTGGCCCAGGTGGGCAGCAGCCCCGCCTGAAGGTGCTC
AAAGGACCCACAGTGCTGACAGAAAGCCCACTGCCTGCCCTGCCAGCCTCGGCTGCCACCTTCCTCATGGACCAACATGAGCCCAGGACACCTGCCTTAGCACTCGCTTCAGGACCTTGTGTCTATGT
TTATAAGAACCTTCGACCCTACTTCAAGTTCAGCCTGCCCCAGTTACCTCCAAACCCTTTGGAACAAGACCTTTGGAACCAAGCCAAAGAGGACCGGATTGACCCCTTAACCCTGAAGGAGATGCTGG
AGGACATCAGGGAAAAGGCAGAGGTGCCTTTGTCTGTGCAGTCACTCAGGTTTCTGCAGCTGGAGCTGAATGAAATGGAGGCGTTTGTGAACCAGCACAAGTCCAAGGTTATCAAGCGTCAGACAGTC
ATCACCACCATGACCACCCTGAAGAAGAACCTGGCAGATGAGGATGCAGTGTCCTGTCTGGTGCTAGGCACTGAGAACAAGGAGCTCCTAGTGCTGGACCCTGAAGCTTTCACCATTTTGACCAAGAT
GAGCCTGCCCAGTGTCCCTGTCTTCCTGGAGGTTTCTGGCCAGTTTGATGTGGAGTTCCGATTGACTGCTGCCTGCCGAGATGGGAGCATCTATATCCTGAGAAGAGACTCCAAACACCCCAAGTACT
GCATCGAGTTGAGTGCCCAGCCTGTGGGGCTGGTCCGGGTACACAAGATCCTGGTGGTGGGCAGCACCCAAGAGAGTCTGCATGGCTTCACCCACAAGGGTAAGAAGCTGTGGACGGTGCAGATGCCT
GCAGCCATCCTGACCATGAACCTTCTGGAGCAGCGATCCCGAGGCCTGCAAGCTGTCATGGCCGCTTTGGCCAATGGGGAAGTCCGGATTTACCGTGACAAGGCCCTGCTCAATGTCGTCCGGGCCCC
TGATGCAGTAACCAGCCTGTGCTTTGGCCGATATGGACGAGAAGATAACACCCTCATCATGACTACTAGAGGTGGGGGCCTGATCATCAAGATCCTGAAGCGCACAGCAGTGTTTGTGGAAGGGACAG
GCGAGGTGGGCCCACCGCTAGCACAGACAACAAAACTCAGTGTGCCCCGAAAGACCCGGCTGTATGTGGATCAGACCCTACGGGAGCGAGAAGCTGGCACAGTCATGCACCGGACCTTCCAGACTGAC
CTCTACCTGCTGCGTCTACGAGCTGCCAGAGCCTATGTTCAGGCCCTGGAGTCCAGCCTGAGCCCCATGTCAGCCACAGCTCGGGAGCCACTCAAGCTGCACGCTGTGGTTCAAGGCCTGGGCCCCAC
CTTTAAGCTCACACTTCACCTGCAGAATACCTCAACGGCTCGGCCAGTACTGGGGCTACAGGTCTGCTTCCTGTACAACGAGGCATTTTATGCCCTGCCTCGGGCCTTCTTTAAGGTTCCCTTGCTGG
TGCCAGGACTCAGTTACCCACTGGAGACCTTTGTAGAGAGTCTCAGCAGCAAGGGCATCTCAGACATAATCAAGGTGCTCGTGCTCCGGGAAGGCCAGAGTGCACCCCTGCTGAGTGCCCACATCAAC
ATGCCTGTGAGTGAAGGTCTGGCAGCTGCCTGAGCCCTGGGCCAGCATTCAAGCCTCCACAAGATGAAGCCAGTCAGATCCAGTGACTTCCAGTGTCACCAGACTACTTCCCCCCAACAGCAGTGTAG
TGAGACATCAGCTCCCTGTTCCTGTCAGACAGTCCCTTGCTCCCCACCTCGGCAAGTGGGCCTGAGCAACAAGACATGGAGTGTTCAGTCAGGTCCTCCCCCCTCAGAACCCACCCAATTACTGTCCC
TTAGTTCCTGATGCCTACCACTCTCCCCAGCTCTTGAAAGACACCTCCCCAGGTCCCAGGACGAGATCTGAGATGGTCAGTGTAAGCAAAGCGCCAGTCCATCCTTCCTCCCCTCCTTCCTTCCTCCT
TCCTTCCTTCCTTCCACTTACCTATTTCAGATCAAGGCCACAGTTGATCAAGGGCTCCAGACGTCAGCTGGTACCAATCCCTCTGCTGCCCTTTGAAGTTTCAGGGACACGGATGCTGCCAGCCTAAT
TTACAGGCACATGTGCTAAGCCTCCTCAGCTGAAGAGAGGCTCCACTTTCTACCCTGAAGCCCAGCAGTCACGGGGCTCTGTCTTAGAGTAGCCACAGAGATTGCCTGAGGAGGTGATGTGGAAGAAG
GGATCTATGTGAGGAGCTAGGTTCACACAGCAGCTGCTCCTGATGTGGATGCTCCTGTCCAGAGATAGTGTTCTGAAATGGAATGCCAAGCAAGATAGCACAGCTAGGGCTGGTGGCACCGGGAGAGG
TGTTTCTGGGACCTGGGAAGTGACCCAAGAGGCAGATGCTGACAAGTGCCTATCAGAATGCACTTAGGTCCAGGAGTTCAAGATGGTCCTGAGGGTGGCATGTTTACTGTGCAGTGGCCAGAATATGC
CTGAGACCACTGAAAAGGTACACAGCAGGGGTATGGAATAAAGCTGAAGACTAAAGGAAGATGTGTTTAGATCTCAAGTGCTGGGACCCCTGGCCCTCCAGACTATTCTGAATCACTTGGGAACCAGG
AGCCCTGCTCCATGGAGAGCACATTTTTCTAGTCGAATCAGGTTCACCTGCTGTGTGGCAGCCAGCTCAGTCTTGCAGGCTTCCACCTCCTCTCCAGTAAAGACAGACGTTGGCCCGCATTAATTCTA
AACCGTTGTCAGCTCTAACACCATTAGAGCTTGGCAGCTCCTCAGGAGGAAGGAAAGAATTGGTCCAAGAAGGTGATACGTCACTACACAGCTTTTGTCCACAAAACCAATGTCTCCAAGCTGGCCAC
CACTGCCCAGTAACAACCTTTGTGCCCACCCAGGGACCAGGGTGACACTGCCTACCTTGTCCCTTCCAAGGGTACTTCAGGAGCCAGACTAAGAGACACTGAGTCTGGACCAAAGAAACAGCCCAAGC
CCTCGAGACAGGCACTGTGTGAGCAAGGATAGCCAGGGGGCACAGCAGGACTAAGTGGGAGGTCTGACTGGAGATGGGAGATGAGAGGTGGGAGGAGTGTTGCTGTGAGTCAGAGACCCCAGCCTAAC
CTGCAACACTAAACAGGGAAGGAAGGTCTGCCCGAGGTGTTGAGCCCCTTGTCACTGTGCCCCGTGTCACTGGTGAATGGGGCTATCACAGGGCCAGGTCGTGTGTTGGATCATGACACTCCACTTTC
ACCCAAGTCAAGCTGTGAAATCAGAACAAAAATATTTGATGTGTGCTCTCTCCATAACTATCTGTGATGATCCAAATTGGTGAGACATATGCCCAGGCCCTACCATGAAACACAGTGTTGTATTACTC
TTGCCTAGTAAGAAATGTGTGACATGTACCTTATGCACATAAAAGAACCATCAACAGTGCAGAGCATCCAATACTCAGAGTGAGAGCTCTAAGAAATTGTGAACCTTAAGGATGAGATGAGTCTATGA
AACACATACCTATGTAGTCATCTGGAATAGACTATTTA

hide sequence

RefSeq Acc Id:

XM_008760137 ⟹ XP_008758359

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	211,614,195 - 211,633,504 (-)	NCBI
mRatBN7.2	1	202,184,812 - 202,204,118 (-)	NCBI
Rnor_6.0	1	220,146,084 - 220,165,545 (-)	NCBI

Sequence:

show sequence

TCTATTGGGCGTTGCTCAACGGCTGGCTGAGCTGGTTGCCAAGACGACGCCTGGGAAGATGGCT
GCGACGACGTCTTCACCGGATTCTGACAGCGGGCGAGCTGAGAGCAACGAAGCCAATTCGAAATGGCTGGATGCACACTACGACCCCATGGCCAACATCCATACCTTCTCCTCCTGCCTGGCACTGGC
AGATTTGCATGGCGACGGGGAGTACAAGCTGGTGGTGGGAGACCTTGGCCCAGGTGGGCAGCAGCCCCGCCTGAAGGTGCTCAAAGGACCCACAGTGCTGACAGAAAGCCCACTGCCTGCCCTGCCAG
CCTCGGCTGCCACCTTCCTCATGGACCAACATGAGCCCAGGACACCTGCCTTAGCACTCGCTTCAGGACCTTGTGTCTATGTTTATAAGAACCTTCGACCCTACTTCAAGTTCAGCCTGCCCCAGTTA
CCTCCAAACCCTTTGGAACAAGACCTTTGGAACCAAGCCAAAGAGGACCGGATTGACCCCTTAACCCTGAAGGAGATGCTGGAGGACATCAGGGAAAAGGCAGAGGTGCCTTTGTCTGTGCAGTCACT
CAGGTTTCTGCAGCTGGAGCTGAATGAAATGGAGGCGTTTGTGAACCAGCACAAGTCCAAGGTTATCAAGCGTCAGACAGTCATCACCACCATGACCACCCTGAAGAAGAACCTGGCAGATGAGGATG
CAGTGTCCTGTCTGGTGCTAGGCACTGAGAACAAGGAGCTCCTAGTGCTGGACCCTGAAGCTTTCACCATTTTGACCAAGATGAGCCTGCCCAGTGTCCCTGTCTTCCTGGAGGTTTCTGGCCAGTTT
GATGTGGAGTTCCGATTGACTGCTGCCTGCCGAGATGGGAGCATCTATATCCTGAGAAGAGACTCCAAACACCCCAAGTACTGCATCGAGTTGAGTGCCCAGCCTGTGGGGCTGGTCCGGGTACACAA
GATCCTGGTGGTGGGCAGCACCCAAGAGAGTCTGCATGGCTTCACCCACAAGGGTAAGAAGCTGTGGACGGTGCAGATGCCTGCAGCCATCCTGACCATGAACCTTCTGGAGCAGCGATCCCGAGGCC
TGCAAGCTGTCATGGCCGCTTTGGCCAATGGGGAAGTCCGGATTTACCGTGACAAGGCCCTGCTCAATGTCGTCCGGGCCCCTGATGCAGTAACCAGCCTGTGCTTTGGCCGATATGGACGAGAAGAT
AACACCCTCATCATGACTACTAGAGGTGGGGGCCTGATCATCAAGATCCTGAAGCGCACAGCAGTGTTTGTGGAAGGGACAGGCGAGGTGGGCCCACCGCTAGCACAGACAACAAAACTCAGTGTGCC
CCGAAAGACCCGGCTGTATGTGGATCAGACCCTACGGGAGCGAGAAGCTGGCACAGTCATGCACCGGACCTTCCAGACTGACCTCTACCTGCTGCGTCTACGAGCTGCCAGAGCCTATGTTCAGGCCC
TGGAGTCCAGCCTGAGCCCCATGTCAGCCACAGCTCGGGAGCCACTCAAGCTGCACGCTGTGGTTCCCTTGCTGGTGCCAGGACTCAGTTACCCACTGGAGACCTTTGTAGAGAGTCTCAGCAGCAAG
GGCATCTCAGACATAATCAAGGTGCTCGTGCTCCGGGAAGGCCAGAGTGCACCCCTGCTGAGTGCCCACATCAACATGCCTGTGAGTGAAGGTCTGGCAGCTGCCTGAGCCCTGGGCCAGCATTCAAG
CCTCCACAAGATGAAGCCAGTCAGATCCAGTGACTTCCAGTGTCACCAGACTACTTCCCCCCAACAGCAGTGTAGTGAGACATCAGCTCCCTGTTCCTGTCAGACAGTCCCTTGCTCCCCACCTCGGC
AAGTGGGCCTGAGCAACAAGACATGGAGTGTTCAGTCAGGTCCTCCCCCCTCAGAACCCACCCAATTACTGTCCCTTAGTTCCTGATGCCTACCACTCTCCCCAGCTCTTGAAAGACACCTCCCCAGG
TCCCAGGACGAGATCTGAGATGGTCAGTGTAAGCAAAGCGCCAGTCCATCCTTCCTCCCCTCCTTCCTTCCTCCTTCCTTCCTTCCTTCCACTTACCTATTTCAGATCAAGGCCACAGTTGATCAAGG
GCTCCAGACGTCAGCTGGTACCAATCCCTCTGCTGCCCTTTGAAGTTTCAGGGACACGGATGCTGCCAGCCTAATTTACAGGCACATGTGCTAAGCCTCCTCAGCTGAAGAGAGGCTCCACTTTCTAC
CCTGAAGCCCAGCAGTCACGGGGCTCTGTCTTAGAGTAGCCACAGAGATTGCCTGAGGAGGTGATGTGGAAGAAGGGATCTATGTGAGGAGCTAGGTTCACACAGCAGCTGCTCCTGATGTGGATGCT
CCTGTCCAGAGATAGTGTTCTGAAATGGAATGCCAAGCAAGATAGCACAGCTAGGGCTGGTGGCACCGGGAGAGGTGTTTCTGGGACCTGGGAAGTGACCCAAGAGGCAGATGCTGACAAGTGCCTAT
CAGAATGCACTTAGGTCCAGGAGTTCAAGATGGTCCTGAGGGTGGCATGTTTACTGTGCAGTGGCCAGAATATGCCTGAGACCACTGAAAAGGTACACAGCAGGGGTATGGAATAAAGCTGAAGACTA
AAGGAAGATGTGTTTAGATCTCAAGTGCTGGGACCCCTGGCCCTCCAGACTATTCTGAATCACTTGGGAACCAGGAGCCCTGCTCCATGGAGAGCACATTTTTCTAGTCGAATCAGGTTCACCTGCTG
TGTGGCAGCCAGCTCAGTCTTGCAGGCTTCCACCTCCTCTCCAGTAAAGACAGACGTTGGCCCGCATTAATTCTAAACCGTTGTCAGCTCTAACACCATTAGAGCTTGGCAGCTCCTCAGGAGGAAGG
AAAGAATTGGTCCAAGAAGGTGATACGTCACTACACAGCTTTTGTCCACAAAACCAATGTCTCCAAGCTGGCCACCACTGCCCAGTAACAACCTTTGTGCCCACCCAGGGACCAGGGTGACACTGCCT
ACCTTGTCCCTTCCAAGGGTACTTCAGGAGCCAGACTAAGAGACACTGAGTCTGGACCAAAGAAACAGCCCAAGCCCTCGAGACAGGCACTGTGTGAGCAAGGATAGCCAGGGGGCACAGCAGGACTA
AGTGGGAGGTCTGACTGGAGATGGGAGATGAGAGGTGGGAGGAGTGTTGCTGTGAGTCAGAGACCCCAGCCTAACCTGCAACACTAAACAGGGAAGGAAGGTCTGCCCGAGGTGTTGAGCCCCTTGTC
ACTGTGCCCCGTGTCACTGGTGAATGGGGCTATCACAGGGCCAGGTCGTGTGTTGGATCATGACACTCCACTTTCACCCAAGTCAAGCTGTGAAATCAGAACAAAAATATTTGATGTGTGCTCTCTCC
ATAACTATCTGTGATGATCCAAATTGGTGAGACATATGCCCAGGCCCTACCATGAAACACAGTGTTGTATTACTCTTGCCTAGTAAGAAATGTGTGACATGTACCTTATGCACATAAAAGAACCATCA
ACAGTGCAGAGCATCCAATACTCAGAGTGAGAGCTCTAAGAAATTGTGAACCTTAAGGATGAGATGAGTCTATGAAACACATACCTATGTAGTCATCTGGAATAGACTATTTAAAATAAAATGCACTC
TTCCCATTCCACAGGACCATTCCTGTACAGCAGCCATTTTCATTAACTATTTTAAATTCTTTTCAGATGTGTGTGGGTAGGAGGAGGTATGTCTGTGAGTACAGATACCCAAGGAGGCCAGAAGAGGG
CATTGGATCCCCAGGAGCCAGAGTTACAGGTGGTTGAGCTACCCTGTATGAATGCTGGCAGCCACACGTGGGTCGTGGGTCATTGGCAAGAGTAAGGGCTCTGCAGCCCCTCTCCACTCTCACTTTGG
TGATCCATCTCAGACATTACCTGTTGACTCCCTGTTGTAAGAGGTTAGTCTTTGGTGCTCTTGAGATGCCCTGTTCTCCATGCTGTAGGTCGTGGGTACTCACTGCTTACATTGCTGTTTATATTGAT
TTGTGAAAGTCTCAGTAAAACTGAGAATTAGGGGTTGGGGATTTAGCTCAGTGGTAGAGGGCTTGCCTAGCAATCGCAAGGCCCTGGGCTCAGTCCCCAGCTCCGAAAAACAGAAAAAGGAAAAAAAC
AAAAAACAAAAAACAAAAAAATCCCTGAGAATTAACTATAACCATTTTTCAAATTTTAGATGTTTTCATGGAATTGGTACTTGCTTAGTTTTCTAATATACCACTGAAAATTCTCCCATCCAACCTCA
GTTCTTTTCTTGGGACACTTCCTTCATACCTTGCTTTTCTGTAGACTTCTCTGTAAGAAAGTTCCCCTTCCTGTTATCCCAGAGTTGGATCCCCTGATTCCTGGGTTCCATGTCTTCTTTCTTATTCT
GCCCTCATTGGGTAAAGCATACCCACAGGTAACTTCATTTCTGGTTGTCAGCTTGGCTACATCTGAAATGAACTATACTCCGGAAATGGAGGGCTCACCTGTGATCCAGACCTTGAGGCTGGAAGACA
GGCTTTTCTGGTTTGGATCTTGAAGCATAGTGACCATGAGAAGTTTAGGCCAGGGAAGGCAATCCATGCCTTTATCCCCAGGAGACAGAGGCAAGCATATCTCTAAATTCCAACCAGCCTGAGGCGGA
ACAAATTCCAAGTGAAGGACAGCTTAGGTCCAGGCGTGACAGACACACCTTCTGCTGGAGGCCTACATCGGGACAGTGGAAGAAGGAAGGCTGCTTCTTTGCCTGCTTGCTTCCTTGTTACTTGCCAG
CACATCAGTTGGAGCCTACTTCTTCAGGATTCCAGCTTATACAGAAGACCAGCTTAAACCCCACGTCTTGTGGGACTGAGCAACTACTAGACTCCTGGACTTGCCATCATAGCTGCCCATTGCTATGG
ATTGCAGCCTGTAAGTCATCCCAATAAATTCCCTTTATAGAGACATGCCATAAATTCTGTGACTCTAGAGAACCCTCACCGAGACACCACCCAAGTCTATCCCATGGCTTGTTTGGACACTGCTGGAC
TCAGTTCACATGTGTAACAGTTTGGGAGGTAGAACAAAGCTGGGAGTAGTTGTCCTATAGACAGCGCTCCCACGTCCTGTGCTCA

hide sequence

RefSeq Acc Id:

XM_039079420 ⟹ XP_038935348

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	211,614,195 - 211,633,330 (-)	NCBI
mRatBN7.2	1	202,184,812 - 202,203,971 (-)	NCBI


Protein RefSeqs	NP_001101039	(Get FASTA)	NCBI Sequence Viewer
	XP_008758359	(Get FASTA)	NCBI Sequence Viewer
	XP_038935348	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM12435	(Get FASTA)	NCBI Sequence Viewer
	EDM12436	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026915.5
	ENSRNOP00000082124
	ENSRNOP00000082124.1
	ENSRNOP00000085404
	ENSRNOP00000085404.1
	ENSRNOP00000087522.1
	ENSRNOP00000087914.1

RefSeq Acc Id:

NP_001101039 ⟸ NM_001107569

- UniProtKB:

D4A4U2 (UniProtKB/TrEMBL), A6HZ05 (UniProtKB/TrEMBL), A0A8I5ZVJ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATTSSPDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLP
QLPPNPLEQDLWNQAKEDRIDPLTLKEMLEDIREKAEVPLSVQSLRFLQLELNEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILTKMSLPSVPVFLEVSG
QFDVEFRLTAACRDGSIYILRRDSKHPKYCIELSAQPVGLVRVHKILVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVVRAPDAVTSLCFGRYGR
EDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTVMHRTFQTDLYLLRLRAARAYVQALESSLSPMSATAREPLKLHAVVQGLGPTFKLTLHLQNTSTA
RPVLGLQVCFLYNEAFYALPRAFFKVPLLVPGLSYPLETFVESLSSKGISDIIKVLVLREGQSAPLLSAHINMPVSEGLAAA

hide sequence

RefSeq Acc Id:	XP_008758359 ⟸ XM_008760137
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6A032 (UniProtKB/TrEMBL), A0A8I5ZVJ8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAATTSSPDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLP QLPPNPLEQDLWNQAKEDRIDPLTLKEMLEDIREKAEVPLSVQSLRFLQLELNEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILTKMSLPSVPVFLEVSG QFDVEFRLTAACRDGSIYILRRDSKHPKYCIELSAQPVGLVRVHKILVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVVRAPDAVTSLCFGRYGR EDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTVMHRTFQTDLYLLRLRAARAYVQALESSLSPMSATAREPLKLHAVVPLLVPGLSYPLETFVESLS SKGISDIIKVLVLREGQSAPLLSAHINMPVSEGLAAA hide sequence

Ensembl Acc Id:

ENSRNOP00000026915 ⟸ ENSRNOT00000026915

RefSeq Acc Id:	XP_038935348 ⟸ XM_039079420
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZVJ8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000082124 ⟸ ENSRNOT00000111822

Protein Domains

Bardet-Biedl syndrome 1 N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4U2-F1-model_v2	AlphaFold	D4A4U2	1-594	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56729	BioCyc
Ensembl Genes	ENSRNOG00000019832	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026915.7	UniProtKB/TrEMBL
	ENSRNOT00000097583	ENTREZGENE
	ENSRNOT00000097583.1	UniProtKB/TrEMBL
	ENSRNOT00000104874.1	UniProtKB/TrEMBL
	ENSRNOT00000110110.1	UniProtKB/TrEMBL
	ENSRNOT00000111822	ENTREZGENE
	ENSRNOT00000111822.1	UniProtKB/TrEMBL
InterPro	BBS1	UniProtKB/TrEMBL
	BBS1_N	UniProtKB/TrEMBL
	Quino_AlcDH-like	UniProtKB/TrEMBL
KEGG Report	rno:309156	UniProtKB/TrEMBL
NCBI Gene	309156	ENTREZGENE
PANTHER	BARDET-BIEDL SYNDROME 1 PROTEIN	UniProtKB/TrEMBL
	PTHR20870	UniProtKB/TrEMBL
Pfam	BBS1	UniProtKB/TrEMBL
PhenoGen	Bbs1	PhenoGen
RatGTEx	ENSRNOG00000019832	RatGTEx
Superfamily-SCOP	Quin_alc_DH_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZVJ8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A032	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6T6_RAT	UniProtKB/TrEMBL
	A0A8I6A851_RAT	UniProtKB/TrEMBL
	A6HZ05	ENTREZGENE, UniProtKB/TrEMBL
	D4A4U2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-11-05	Bbs1	Bardet-Biedl syndrome 1	Bbs1	Bardet-Biedl syndrome 1 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Bbs1	Bardet-Biedl syndrome 1 homolog (human)	Bbs1_predicted	Bardet-Biedl syndrome 1 homolog (human) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Bbs1_predicted	Bardet-Biedl syndrome 1 homolog (human) (predicted)		Bardet-Biedl syndrome 1 (predicted)	Name updated	1299863	APPROVED
2005-01-12	Bbs1_predicted	Bardet-Biedl syndrome 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM