Symbol:
Pls1
Name:
plastin 1
RGD ID:
1307142
Description:
Predicted to enable actin filament binding activity. Predicted to be involved in several processes, including actin filament organization; inner ear receptor cell stereocilium organization; and intestinal D-glucose absorption. Predicted to act upstream of or within terminal web assembly. Predicted to be located in several cellular components, including brush border; stereocilium; and terminal web. Predicted to be active in actin filament; actin filament bundle; and cytoplasm. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 76. Orthologous to human PLS1 (plastin 1); PARTICIPATES IN auditory mechanotransduction pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC315926; MGC189074; plastin 1 (I isoform); plastin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLS1 (plastin 1) HGNC
Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pls1 (plastin 1 (I-isoform)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pls1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLS1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLS1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pls1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLS1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLS1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pls1 (plastin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RPS29 (ribosomal protein S29) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PLS1 (plastin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pls1 (plastin 1 (I-isoform))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pls1 (plastin 1 (I isoform))
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Fim
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SAC6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
plst-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pls1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 105,196,312 - 105,306,252 (-) NCBI GRCr8 mRatBN7.2 8 96,316,703 - 96,426,592 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 96,317,849 - 96,385,195 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 101,983,678 - 102,015,932 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 100,182,931 - 100,215,183 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 98,021,875 - 98,054,127 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 103,557,361 - 103,659,625 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 103,557,364 - 103,608,913 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 103,008,357 - 103,110,153 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 100,825,543 - 100,858,153 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 100,845,099 - 100,913,858 (-) NCBI Celera 8 95,763,631 - 95,795,453 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pls1 Rat (-)-epigallocatechin 3-gallate increases expression ISO PLS1 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PLS1 protein CTD PMID:31195006 Pls1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PLS1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLS1 mRNA CTD PMID:22079256 Pls1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pls1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PLS1 mRNA CTD PMID:36331819 Pls1 Rat 1,2-dichloroethane decreases expression ISO Pls1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PLS1 mRNA CTD PMID:28189721 and PMID:28960355 Pls1 Rat 1,2-dimethylhydrazine decreases expression ISO Pls1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PLS1 mRNA CTD PMID:22206623 Pls1 Rat 1-benzofuran affects expression ISO Pls1 (Mus musculus) 6480464 benzofuran affects the expression of PLS1 mRNA CTD PMID:17114358 Pls1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLS1 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLS1 mRNA CTD PMID:26496021 and PMID:32741896 Pls1 Rat 17beta-estradiol multiple interactions ISO PLS1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PLS1 mRNA CTD PMID:30165855 Pls1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLS1 mRNA CTD PMID:32741896 Pls1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Pls1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Pls1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PLS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pls1 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO PLS1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Pls1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pls1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLS1 mRNA CTD PMID:19770486 Pls1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pls1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLS1 mRNA CTD PMID:28922406 Pls1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pls1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLS1 mRNA CTD PMID:26377647 Pls1 Rat 2,4,6-tribromophenol decreases expression ISO PLS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Pls1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PLS1 mRNA CTD PMID:21346803 Pls1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO PLS1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of PLS1 protein CTD PMID:31675489 Pls1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PLS1 protein CTD PMID:34915118 Pls1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pls1 (Mus musculus) 6480464 bisphenol S results in increased expression of PLS1 mRNA CTD PMID:30951980 Pls1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PLS1 mRNA CTD PMID:31881176 Pls1 Rat acrolein multiple interactions ISO PLS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PLS1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PLS1 mRNA CTD PMID:32699268 Pls1 Rat afimoxifene multiple interactions ISO PLS1 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of PLS1 mRNA] CTD PMID:21233418 Pls1 Rat alpha-pinene multiple interactions ISO PLS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PLS1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PLS1 mRNA CTD PMID:32699268 Pls1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLS1 mRNA CTD PMID:35163327 Pls1 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of PLS1 mRNA CTD PMID:35163327 Pls1 Rat amiodarone increases expression ISO PLS1 (Homo sapiens) 6480464 Amiodarone results in increased expression of PLS1 mRNA CTD PMID:19774075 Pls1 Rat antirheumatic drug decreases expression ISO PLS1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PLS1 mRNA CTD PMID:24449571 Pls1 Rat arsane affects methylation ISO PLS1 (Homo sapiens) 6480464 Arsenic affects the methylation of PLS1 gene CTD PMID:25304211 Pls1 Rat arsenic atom affects methylation ISO PLS1 (Homo sapiens) 6480464 Arsenic affects the methylation of PLS1 gene CTD PMID:25304211 Pls1 Rat benzo[a]pyrene decreases expression ISO Pls1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PLS1 mRNA CTD PMID:19770486 Pls1 Rat benzo[a]pyrene increases expression ISO Pls1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PLS1 mRNA CTD PMID:32417428 Pls1 Rat benzo[a]pyrene decreases methylation ISO PLS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PLS1 promoter CTD PMID:27901495 Pls1 Rat beta-lapachone increases expression ISO PLS1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PLS1 mRNA CTD PMID:38218311 Pls1 Rat beta-lapachone decreases expression ISO PLS1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PLS1 mRNA CTD PMID:38218311 Pls1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PLS1 mRNA CTD PMID:26496021 Pls1 Rat bisphenol A decreases expression ISO Pls1 (Mus musculus) 6480464 bisphenol A results in decreased expression of PLS1 protein CTD PMID:35999755 Pls1 Rat bisphenol A multiple interactions ISO Pls1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of PLS1 protein CTD PMID:35999755 Pls1 Rat bisphenol A decreases expression ISO PLS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLS1 protein CTD PMID:31675489 Pls1 Rat bisphenol A increases expression ISO Pls1 (Mus musculus) 6480464 bisphenol A results in increased expression of PLS1 mRNA CTD PMID:34585602 Pls1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLS1 mRNA CTD PMID:32145629 Pls1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLS1 mRNA CTD PMID:25181051 and PMID:34947998 Pls1 Rat bisphenol F increases expression ISO Pls1 (Mus musculus) 6480464 bisphenol F results in increased expression of PLS1 mRNA CTD PMID:30951980 Pls1 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of PLS1 mRNA CTD PMID:32479839 Pls1 Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat caffeine increases expression ISO PLS1 (Homo sapiens) 6480464 Caffeine results in increased expression of PLS1 protein CTD PMID:31195006 Pls1 Rat carbamazepine affects expression ISO PLS1 (Homo sapiens) 6480464 Carbamazepine affects the expression of PLS1 mRNA CTD PMID:25979313 Pls1 Rat CGP 52608 multiple interactions ISO PLS1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PLS1 gene] CTD PMID:28238834 Pls1 Rat chlordecone decreases expression ISO Pls1 (Mus musculus) 6480464 Chlordecone results in decreased expression of PLS1 mRNA CTD PMID:33711761 Pls1 Rat chlorpyrifos decreases expression ISO Pls1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PLS1 mRNA CTD PMID:37019170 Pls1 Rat chromium(6+) affects expression ISO Pls1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PLS1 mRNA CTD PMID:28472532 Pls1 Rat chromium(6+) affects expression ISO PLS1 (Homo sapiens) 6480464 chromium hexavalent ion affects the expression of PLS1 mRNA CTD PMID:30690063 Pls1 Rat cisplatin multiple interactions ISO PLS1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [Piroxicam results in decreased expression of PLS1 mRNA] CTD PMID:21858171 Pls1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PLS1 mRNA CTD PMID:24386269 Pls1 Rat cyclosporin A decreases expression ISO PLS1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PLS1 mRNA CTD PMID:20106945 Pls1 Rat cyclosporin A decreases expression ISO Pls1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PLS1 mRNA CTD PMID:19770486 Pls1 Rat decabromodiphenyl ether decreases expression ISO PLS1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of PLS1 protein CTD PMID:31675489 Pls1 Rat deguelin decreases expression ISO PLS1 (Homo sapiens) 6480464 deguelin results in decreased expression of PLS1 mRNA CTD PMID:33512557 Pls1 Rat dextran sulfate multiple interactions ISO Pls1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of PLS1 protein CTD PMID:35999755 Pls1 Rat dextran sulfate decreases expression ISO Pls1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PLS1 protein CTD PMID:35999755 Pls1 Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat dicrotophos decreases expression ISO PLS1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PLS1 mRNA CTD PMID:28302478 Pls1 Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PLS1 mRNA CTD PMID:31199487 Pls1 Rat dioxygen decreases expression ISO PLS1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of PLS1 mRNA CTD PMID:26516004 Pls1 Rat dorsomorphin multiple interactions ISO PLS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pls1 Rat doxorubicin decreases expression ISO PLS1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLS1 mRNA CTD PMID:29803840 Pls1 Rat entinostat increases expression ISO PLS1 (Homo sapiens) 6480464 entinostat results in increased expression of PLS1 mRNA CTD PMID:26272509 Pls1 Rat entinostat multiple interactions ISO PLS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLS1 mRNA CTD PMID:27188386 Pls1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PLS1 mRNA CTD PMID:24136188 Pls1 Rat GW 4064 increases expression ISO Pls1 (Mus musculus) 6480464 GW 4064 results in increased expression of PLS1 mRNA CTD PMID:26655953 Pls1 Rat inulin multiple interactions ISO Pls1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PLS1 mRNA CTD PMID:36331819 Pls1 Rat ivermectin decreases expression ISO PLS1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PLS1 protein CTD PMID:32959892 Pls1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PLS1 gene CTD PMID:35440735 Pls1 Rat methylmercury chloride decreases expression ISO PLS1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLS1 mRNA CTD PMID:23179753 and PMID:27188386 Pls1 Rat mono(2-ethylhexyl) phthalate affects expression ISO Pls1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate affects the expression of PLS1 mRNA CTD PMID:21195148 Pls1 Rat Monobutylphthalate affects expression ISO Pls1 (Mus musculus) 6480464 monobutyl phthalate affects the expression of PLS1 mRNA CTD PMID:21195148 Pls1 Rat N-nitrosodiethylamine multiple interactions ISO Pls1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of PLS1 mRNA CTD PMID:24535843 Pls1 Rat N-nitrosodiethylamine increases expression ISO Pls1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PLS1 mRNA CTD PMID:24535843 Pls1 Rat naphthalene-1,5-diamine affects expression ISO Pls1 (Mus musculus) 6480464 1 and 5-naphthalenediamine affects the expression of PLS1 mRNA CTD PMID:17114358 Pls1 Rat nitrates multiple interactions ISO Pls1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PLS1 mRNA CTD PMID:35964746 Pls1 Rat ozone multiple interactions ISO PLS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PLS1 mRNA more ... CTD PMID:32699268 Pls1 Rat ozone multiple interactions ISO Pls1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PLS1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PLS1 mRNA CTD PMID:34911549 Pls1 Rat paracetamol decreases expression ISO PLS1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLS1 mRNA CTD PMID:21420995 more ... Pls1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PLS1 mRNA CTD PMID:33387578 Pls1 Rat perfluorohexanesulfonic acid decreases expression ISO PLS1 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of PLS1 mRNA CTD PMID:25812627 Pls1 Rat perfluorononanoic acid decreases expression ISO PLS1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PLS1 mRNA CTD PMID:25812627 Pls1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pls1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PLS1 mRNA more ... CTD PMID:36331819 Pls1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLS1 mRNA CTD PMID:35163327 Pls1 Rat perfluorooctanoic acid decreases expression ISO PLS1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PLS1 mRNA CTD PMID:25812627 Pls1 Rat phenobarbital multiple interactions ISO Pls1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of PLS1 mRNA CTD PMID:24535843 Pls1 Rat phenobarbital affects expression ISO Pls1 (Mus musculus) 6480464 Phenobarbital affects the expression of PLS1 mRNA CTD PMID:23091169 Pls1 Rat phenobarbital affects expression ISO PLS1 (Homo sapiens) 6480464 Phenobarbital affects the expression of PLS1 mRNA CTD PMID:19159669 Pls1 Rat piroxicam multiple interactions ISO PLS1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [Piroxicam results in decreased expression of PLS1 mRNA] CTD PMID:21858171 Pls1 Rat piroxicam decreases expression ISO PLS1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of PLS1 mRNA CTD PMID:21858171 Pls1 Rat potassium chromate decreases expression ISO PLS1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PLS1 mRNA CTD PMID:22079256 Pls1 Rat potassium chromate increases expression ISO PLS1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PLS1 mRNA CTD PMID:22714537 Pls1 Rat potassium chromate multiple interactions ISO PLS1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PLS1 mRNA CTD PMID:22079256 Pls1 Rat quercetin decreases expression ISO PLS1 (Homo sapiens) 6480464 Quercetin results in decreased expression of PLS1 mRNA CTD PMID:21632981 Pls1 Rat rotenone decreases expression ISO PLS1 (Homo sapiens) 6480464 Rotenone results in decreased expression of PLS1 mRNA CTD PMID:33512557 Pls1 Rat SB 431542 multiple interactions ISO PLS1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pls1 Rat silicon dioxide decreases expression ISO PLS1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PLS1 mRNA CTD PMID:25895662 Pls1 Rat silver atom decreases expression ISO Pls1 (Mus musculus) 6480464 Silver results in decreased expression of PLS1 mRNA CTD PMID:27131904 Pls1 Rat silver(0) decreases expression ISO Pls1 (Mus musculus) 6480464 Silver results in decreased expression of PLS1 mRNA CTD PMID:27131904 Pls1 Rat sodium arsenate increases expression ISO Pls1 (Mus musculus) 6480464 sodium arsenate results in increased expression of PLS1 mRNA CTD PMID:30953684 Pls1 Rat sodium arsenite decreases expression ISO PLS1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PLS1 mRNA CTD PMID:38568856 Pls1 Rat temozolomide increases expression ISO PLS1 (Homo sapiens) 6480464 Temozolomide results in increased expression of PLS1 mRNA CTD PMID:31758290 Pls1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLS1 mRNA CTD PMID:32741896 Pls1 Rat testosterone decreases expression ISO PLS1 (Homo sapiens) 6480464 Testosterone results in decreased expression of PLS1 mRNA CTD PMID:33359661 Pls1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PLS1 mRNA CTD PMID:31150632 Pls1 Rat thiram decreases expression ISO PLS1 (Homo sapiens) 6480464 Thiram results in decreased expression of PLS1 mRNA CTD PMID:38568856 Pls1 Rat titanium dioxide decreases methylation ISO Pls1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PLS1 gene CTD PMID:35295148 Pls1 Rat tributylstannane increases expression ISO Pls1 (Mus musculus) 6480464 tributyltin results in increased expression of PLS1 mRNA CTD PMID:31939706 Pls1 Rat trichostatin A increases expression ISO PLS1 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLS1 mRNA CTD PMID:24935251 Pls1 Rat trichostatin A affects expression ISO PLS1 (Homo sapiens) 6480464 trichostatin A affects the expression of PLS1 mRNA CTD PMID:28542535 Pls1 Rat valproic acid affects expression ISO PLS1 (Homo sapiens) 6480464 Valproic Acid affects the expression of PLS1 mRNA CTD PMID:25979313 Pls1 Rat valproic acid increases expression ISO PLS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLS1 mRNA CTD PMID:19101580 more ... Pls1 Rat valproic acid multiple interactions ISO PLS1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLS1 mRNA CTD PMID:27188386 Pls1 Rat vorinostat increases expression ISO PLS1 (Homo sapiens) 6480464 vorinostat results in increased expression of PLS1 mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-benzofuran (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrolein (ISO) afimoxifene (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) amiodarone (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) Butylbenzyl phthalate (EXP) caffeine (ISO) carbamazepine (ISO) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) glafenine (EXP) GW 4064 (ISO) inulin (ISO) ivermectin (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) Monobutylphthalate (ISO) N-nitrosodiethylamine (ISO) naphthalene-1,5-diamine (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) piroxicam (ISO) potassium chromate (ISO) quercetin (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) temozolomide (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichostatin A (ISO) valproic acid (ISO) vorinostat (ISO)
Pls1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 105,196,312 - 105,306,252 (-) NCBI GRCr8 mRatBN7.2 8 96,316,703 - 96,426,592 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 96,317,849 - 96,385,195 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 101,983,678 - 102,015,932 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 100,182,931 - 100,215,183 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 98,021,875 - 98,054,127 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 103,557,361 - 103,659,625 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 103,557,364 - 103,608,913 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 103,008,357 - 103,110,153 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 100,825,543 - 100,858,153 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 100,845,099 - 100,913,858 (-) NCBI Celera 8 95,763,631 - 95,795,453 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
PLS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 142,596,393 - 142,713,664 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 142,596,393 - 142,713,664 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 142,315,235 - 142,432,506 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 143,825,034 - 143,915,191 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 143,825,041 - 143,915,199 NCBI Celera 3 140,738,741 - 140,856,000 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI HuRef 3 139,687,922 - 139,805,221 (+) NCBI HuRef CHM1_1 3 142,278,265 - 142,395,516 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 145,343,653 - 145,460,901 (+) NCBI T2T-CHM13v2.0
Pls1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 95,634,695 - 95,727,359 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 95,634,695 - 95,727,364 (-) Ensembl GRCm39 Ensembl GRCm38 9 95,752,642 - 95,845,306 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 95,752,642 - 95,845,311 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 95,653,061 - 95,745,698 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 95,563,391 - 95,654,612 (-) NCBI MGSCv36 mm8 Celera 9 95,319,770 - 95,411,700 (-) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 50.22 NCBI
Pls1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955508 3,213,646 - 3,260,554 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955508 3,215,304 - 3,324,240 (-) NCBI ChiLan1.0 ChiLan1.0
PLS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 140,490,165 - 140,623,025 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 140,494,897 - 140,627,757 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 139,629,825 - 139,747,080 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 147,221,909 - 147,338,600 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 147,289,205 - 147,338,600 (+) Ensembl panpan1.1 panPan2
PLS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 38,243,631 - 38,347,195 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 38,243,024 - 38,347,202 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 38,170,597 - 38,273,260 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 38,775,761 - 38,879,245 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 38,775,186 - 38,879,252 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 38,457,792 - 38,561,305 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 38,534,253 - 38,637,869 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 38,778,573 - 38,881,960 (+) NCBI UU_Cfam_GSD_1.0
Pls1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 77,466,080 - 77,583,189 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936540 4,205,844 - 4,323,120 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936540 4,205,871 - 4,323,121 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLS1
PLS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 47,919,807 - 48,031,158 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 47,919,823 - 48,003,805 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 20,854,232 - 20,965,494 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pls1
.
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 39 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000013209 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH134294
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 96,318,132 - 96,318,327 (+) MAPPER mRatBN7.2 Rnor_6.0 8 103,558,789 - 103,558,983 NCBI Rnor6.0 Rnor_5.0 8 103,009,785 - 103,009,979 UniSTS Rnor5.0 RGSC_v3.4 8 100,825,828 - 100,826,022 UniSTS RGSC3.4 Celera 8 95,763,916 - 95,764,110 UniSTS RH 3.4 Map 8 1056.7 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
48
113
91
90
59
25
59
6
214
93
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013209 ⟹ ENSRNOP00000013209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 96,317,849 - 96,385,195 (-) Ensembl Rnor_6.0 Ensembl 8 103,557,364 - 103,608,913 (-) Ensembl
RefSeq Acc Id:
NM_001108178 ⟹ NP_001101648
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 105,197,454 - 105,229,339 (-) NCBI mRatBN7.2 8 96,317,848 - 96,349,733 (-) NCBI Rnor_6.0 8 103,558,504 - 103,596,278 (-) NCBI Rnor_5.0 8 103,008,357 - 103,110,153 (-) NCBI RGSC_v3.4 8 100,825,543 - 100,858,153 (-) RGD Celera 8 95,763,631 - 95,795,453 (-) RGD
Sequence:
CGGTAGCCTTTTCAGATCGCTCGCAGATGGCATCCTTCTTTGCAAAATGATCAACTTATCTGAACCAGACACGATTGACGAAAGAGCCATCAATAAGAAGAAGCTCACTCCGTTCACCGTGTCGGAAA
hide sequence
RefSeq Acc Id:
XM_006243574 ⟹ XP_006243636
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 105,196,312 - 105,292,487 (-) NCBI mRatBN7.2 8 96,316,703 - 96,412,828 (-) NCBI Rnor_6.0 8 103,557,361 - 103,659,625 (-) NCBI Rnor_5.0 8 103,008,357 - 103,110,153 (-) NCBI
Sequence:
CGCAGTGGCGCGAGCGCAGGGGCTAGGAGGCGGGCGAGAAGTAGCCGCAGCAGAGTGGACCAGA
hide sequence
RefSeq Acc Id:
XM_039081542 ⟹ XP_038937470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 105,196,312 - 105,306,252 (-) NCBI mRatBN7.2 8 96,316,705 - 96,426,592 (-) NCBI
RefSeq Acc Id:
XM_063265574 ⟹ XP_063121644
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 105,196,312 - 105,264,488 (-) NCBI
RefSeq Acc Id:
NP_001101648 ⟸ NM_001108178
- UniProtKB:
A0A0G2QC04 (UniProtKB/TrEMBL)
- Sequence:
MINLSEPDTIDERAINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLKEGEELEELMKLSPEELLLRWVNYHLTNAGWRTISNFSQDI
hide sequence
RefSeq Acc Id:
XP_006243636 ⟸ XM_006243574
- Peptide Label:
isoform X1
- Sequence:
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILVVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSYSEEEKVAF
hide sequence
Ensembl Acc Id:
ENSRNOP00000013209 ⟸ ENSRNOT00000013209
RefSeq Acc Id:
XP_038937470 ⟸ XM_039081542
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063121644 ⟸ XM_063265574
- Peptide Label:
isoform X1
RGD ID: 13696188 Promoter ID: EPDNEW_R6712 Type: initiation region Name: Pls1_1 Description: plastin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 103,608,975 - 103,609,035 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Pls1
plastin 1
Pls1
plastin 1 (I isoform)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pls1
plastin 1 (I isoform)
Pls1_predicted
plastin 1 (I isoform) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pls1_predicted
plastin 1 (I isoform) (predicted)
Symbol and Name status set to approved
70820 APPROVED
