Symbol:
Col9a2
Name:
collagen type IX alpha 2 chain
RGD ID:
1307029
Description:
Predicted to enable protein homodimerization activity. Predicted to be an extracellular matrix structural constituent conferring tensile strength. Predicted to be involved in extracellular matrix organization. Predicted to be part of collagen type IX trimer. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Human ortholog(s) of this gene implicated in Stickler syndrome; multiple epiphyseal dysplasia 2; and osteochondrodysplasia. Orthologous to human COL9A2 (collagen type IX alpha 2 chain); PARTICIPATES IN syndecan signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
alpha 1 type IX collagen; collagen alpha-2(IX) chain; collagen, type IX, alpha 2; LOC362584; procollagen, type IX, alpha 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
COL9A2 (collagen type IX alpha 2 chain) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Col9a2 (collagen, type IX, alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Col9a2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
COL9A2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
COL9A2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Col9a2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
COL9A2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
COL9A2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Col9a2 (collagen type IX alpha 2 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
COL9A2 (collagen type IX alpha 2 chain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Col9a2 (collagen, type IX, alpha 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
col9a2 (procollagen, type IX, alpha 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
col-135
Alliance
DIOPT (InParanoid|PhylomeDB)
Caenorhabditis elegans (roundworm):
col-179
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
col9a2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,892,798 - 139,910,131 (+) NCBI GRCr8 mRatBN7.2 5 134,607,616 - 134,624,678 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,607,616 - 134,624,677 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,334,851 - 137,351,965 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,091,336 - 139,108,459 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,111,939 - 139,129,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,962,684 - 139,979,865 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,963,002 - 139,979,864 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,756,118 - 143,773,306 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,623,365 - 141,640,224 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,628,590 - 141,645,447 (+) NCBI Celera 5 133,161,241 - 133,178,394 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Col9a2 Rat 17beta-estradiol multiple interactions ISO RGD:1315981 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of COL9A2 mRNA CTD PMID:30165855 Col9a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of COL9A2 mRNA CTD PMID:22298810 Col9a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of COL9A2 mRNA CTD PMID:33387578 Col9a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1315982 6480464 TIPARP gene mutant form promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of COL9A2 mRNA] CTD PMID:34129049 Col9a2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1315982 6480464 Tetrachlorodibenzodioxin results in increased expression of COL9A2 mRNA CTD PMID:16120747|PMID:27562557 Col9a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1315982 6480464 Tetrachlorodibenzodioxin affects the expression of COL9A2 mRNA CTD PMID:26377647 Col9a2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1315981 6480464 bisphenol S results in decreased methylation of COL9A2 gene CTD PMID:31601247 Col9a2 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1315982 6480464 bisphenol S affects the methylation of COL9A2 gene CTD PMID:31683443 Col9a2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of COL9A2 mRNA CTD PMID:24780913|PMID:25825206|PMID:30047161 Col9a2 Rat acrylamide decreases expression ISO RGD:1315981 6480464 Acrylamide results in decreased expression of COL9A2 mRNA CTD PMID:32763439 Col9a2 Rat actinomycin D multiple interactions ISO RGD:1315981 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of COL9A2 mRNA CTD PMID:38460933 Col9a2 Rat aflatoxin B1 increases expression ISO RGD:1315981 6480464 Aflatoxin B1 results in increased expression of COL9A2 mRNA CTD PMID:21641981 Col9a2 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1315981 6480464 aflatoxin B2 results in increased methylation of COL9A2 exon CTD PMID:30157460 Col9a2 Rat alendronic acid multiple interactions ISO RGD:1315981 6480464 Alendronate inhibits the reaction [TNF protein results in increased expression of COL9A2 mRNA] CTD PMID:33522294 Col9a2 Rat alendronic acid increases expression ISO RGD:1315981 6480464 Alendronate results in increased expression of COL9A2 mRNA CTD PMID:33522294 Col9a2 Rat all-trans-retinoic acid increases expression ISO RGD:1315982 6480464 Tretinoin results in increased expression of COL9A2 mRNA CTD PMID:16604517 Col9a2 Rat all-trans-retinoic acid increases expression ISO RGD:1315981 6480464 Tretinoin results in increased expression of COL9A2 mRNA CTD PMID:16140955 Col9a2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of COL9A2 mRNA CTD PMID:35163327 Col9a2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of COL9A2 mRNA CTD PMID:30047161 Col9a2 Rat aristolochic acid A decreases expression ISO RGD:1315981 6480464 aristolochic acid I results in decreased expression of COL9A2 mRNA CTD PMID:33212167 Col9a2 Rat arsane increases expression ISO RGD:1315981 6480464 Arsenic results in increased expression of COL9A2 mRNA CTD PMID:36861143 Col9a2 Rat arsenic atom increases expression ISO RGD:1315981 6480464 Arsenic results in increased expression of COL9A2 mRNA CTD PMID:36861143 Col9a2 Rat arsenite(3-) increases methylation ISO RGD:1315981 6480464 arsenite results in increased methylation of COL9A2 promoter CTD PMID:23974009 Col9a2 Rat benzo[a]pyrene affects expression ISO RGD:1315982 6480464 Benzo(a)pyrene affects the expression of COL9A2 mRNA CTD PMID:22342234 Col9a2 Rat benzo[a]pyrene decreases methylation ISO RGD:1315981 6480464 Benzo(a)pyrene results in decreased methylation of COL9A2 promoter CTD PMID:27901495 Col9a2 Rat benzo[a]pyrene affects methylation ISO RGD:1315981 6480464 Benzo(a)pyrene affects the methylation of COL9A2 3' UTR CTD PMID:27901495 Col9a2 Rat benzo[e]pyrene increases methylation ISO RGD:1315981 6480464 benzo(e)pyrene results in increased methylation of COL9A2 exon CTD PMID:30157460 Col9a2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1315981 6480464 Diethylhexyl Phthalate results in decreased expression of COL9A2 mRNA CTD PMID:31163220 Col9a2 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1315982 6480464 Diethylhexyl Phthalate results in increased expression of COL9A2 mRNA CTD PMID:33754040 Col9a2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of COL9A2 mRNA CTD PMID:25181051 Col9a2 Rat bisphenol A decreases expression ISO RGD:1315982 6480464 bisphenol A results in decreased expression of COL9A2 mRNA CTD PMID:32156529 Col9a2 Rat bisphenol A decreases methylation ISO RGD:1315981 6480464 bisphenol A results in decreased methylation of COL9A2 gene CTD PMID:31601247 Col9a2 Rat bisphenol A increases expression ISO RGD:1315981 6480464 bisphenol A results in increased expression of COL9A2 mRNA CTD PMID:29275510 Col9a2 Rat bisphenol A decreases methylation ISO RGD:1315982 6480464 bisphenol A results in decreased methylation of COL9A2 promoter CTD PMID:27312807 Col9a2 Rat bleomycin A2 increases expression ISO RGD:1315982 6480464 Bleomycin results in increased expression of COL9A2 mRNA CTD PMID:36087614 Col9a2 Rat camptothecin increases expression ISO RGD:1315981 6480464 Camptothecin results in increased expression of COL9A2 mRNA CTD PMID:38460933 Col9a2 Rat chlordecone increases expression ISO RGD:1315982 6480464 Chlordecone results in increased expression of COL9A2 mRNA CTD PMID:33711761 Col9a2 Rat cisplatin multiple interactions ISO RGD:1315981 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of COL9A2 mRNA CTD PMID:27392435 Col9a2 Rat cisplatin increases expression ISO RGD:1315981 6480464 Cisplatin results in increased expression of COL9A2 mRNA CTD PMID:27392435|PMID:27594783 Col9a2 Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of COL9A2 mRNA CTD PMID:30047161 Col9a2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of COL9A2 mRNA CTD PMID:26577399|PMID:27523638 Col9a2 Rat cyclosporin A decreases expression ISO RGD:1315981 6480464 Cyclosporine results in decreased expression of COL9A2 mRNA CTD PMID:20106945 Col9a2 Rat Dibutyl phosphate affects expression ISO RGD:1315981 6480464 di-n-butylphosphoric acid affects the expression of COL9A2 mRNA CTD PMID:37042841 Col9a2 Rat dorsomorphin multiple interactions ISO RGD:1315981 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Col9a2 Rat doxorubicin increases expression ISO RGD:1315982 6480464 Doxorubicin results in increased expression of COL9A2 mRNA CTD PMID:36227756 Col9a2 Rat entinostat increases expression ISO RGD:1315981 6480464 entinostat results in increased expression of COL9A2 mRNA CTD PMID:27188386 Col9a2 Rat genistein increases expression ISO RGD:1315982 6480464 Genistein results in increased expression of COL9A2 mRNA CTD PMID:32186404 Col9a2 Rat MeIQx increases expression ISO RGD:1315981 6480464 2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline results in increased expression of COL9A2 mRNA CTD PMID:20816883 Col9a2 Rat methapyrilene increases methylation ISO RGD:1315981 6480464 Methapyrilene results in increased methylation of COL9A2 exon CTD PMID:30157460 Col9a2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of COL9A2 mRNA CTD PMID:30047161 Col9a2 Rat methylmercury chloride decreases expression ISO RGD:1315981 6480464 methylmercuric chloride results in decreased expression of COL9A2 mRNA CTD PMID:28001369 Col9a2 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1315981 6480464 1-Methyl-4-phenylpyridinium results in increased expression of COL9A2 mRNA CTD PMID:24810058 Col9a2 Rat Nutlin-3 multiple interactions ISO RGD:1315981 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of COL9A2 mRNA CTD PMID:38460933 Col9a2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of COL9A2 mRNA CTD PMID:32680482 Col9a2 Rat pentanal increases expression ISO RGD:1315981 6480464 pentanal results in increased expression of COL9A2 mRNA CTD PMID:26079696 Col9a2 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1315982 6480464 perfluorohexanesulfonic acid results in increased expression of COL9A2 mRNA CTD PMID:37995155 Col9a2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of COL9A2 mRNA CTD PMID:35163327 Col9a2 Rat potassium dichromate increases expression ISO RGD:1315982 6480464 Potassium Dichromate results in increased expression of COL9A2 mRNA CTD PMID:23608068 Col9a2 Rat rotenone decreases expression ISO RGD:1315981 6480464 Rotenone results in decreased expression of COL9A2 mRNA CTD PMID:32178731 Col9a2 Rat SB 431542 multiple interactions ISO RGD:1315981 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Col9a2 Rat sodium arsenite increases expression ISO RGD:1315981 6480464 sodium arsenite results in increased expression of COL9A2 mRNA CTD PMID:38568856 Col9a2 Rat sotorasib multiple interactions ISO RGD:1315981 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of COL9A2 mRNA CTD PMID:36139627 Col9a2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of COL9A2 mRNA CTD PMID:30047161 Col9a2 Rat thimerosal decreases expression ISO RGD:1315981 6480464 Thimerosal results in decreased expression of COL9A2 mRNA CTD PMID:27188386 Col9a2 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of COL9A2 mRNA CTD PMID:30012374 Col9a2 Rat titanium dioxide decreases methylation ISO RGD:1315982 6480464 titanium dioxide results in decreased methylation of COL9A2 gene CTD PMID:35295148 Col9a2 Rat trametinib multiple interactions ISO RGD:1315981 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of COL9A2 mRNA CTD PMID:36139627 Col9a2 Rat triphenyl phosphate affects expression ISO RGD:1315981 6480464 triphenyl phosphate affects the expression of COL9A2 mRNA CTD PMID:37042841 Col9a2 Rat valproic acid affects expression ISO RGD:1315981 6480464 Valproic Acid affects the expression of COL9A2 mRNA CTD PMID:25979313 Col9a2 Rat valproic acid multiple interactions ISO RGD:1315981 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Col9a2 Rat valproic acid increases expression ISO RGD:1315981 6480464 Valproic Acid results in increased expression of COL9A2 mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:27188386|PMID:28001369 Col9a2 Rat vorinostat increases expression ISO RGD:1315981 6480464 vorinostat results in increased expression of COL9A2 mRNA CTD PMID:26272509 Col9a2 Rat vorinostat multiple interactions ISO RGD:1315981 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Col9a2 Rat zoledronic acid increases expression ISO RGD:1315981 6480464 zoledronic acid results in increased expression of COL9A2 mRNA CTD PMID:24714768
Imported Annotations - PID (archival)
Col9a2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,892,798 - 139,910,131 (+) NCBI GRCr8 mRatBN7.2 5 134,607,616 - 134,624,678 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,607,616 - 134,624,677 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,334,851 - 137,351,965 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,091,336 - 139,108,459 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,111,939 - 139,129,051 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,962,684 - 139,979,865 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,963,002 - 139,979,864 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,756,118 - 143,773,306 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,623,365 - 141,640,224 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,628,590 - 141,645,447 (+) NCBI Celera 5 133,161,241 - 133,178,394 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
COL9A2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 40,300,489 - 40,317,286 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 40,300,489 - 40,317,813 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 40,766,161 - 40,782,958 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 40,538,750 - 40,555,526 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 40,435,255 - 40,452,032 NCBI Celera 1 39,048,555 - 39,065,331 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 38,884,657 - 38,901,435 (-) NCBI HuRef CHM1_1 1 40,882,092 - 40,898,880 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 40,169,995 - 40,187,371 (-) NCBI T2T-CHM13v2.0
Col9a2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 120,896,763 - 120,912,522 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 120,896,582 - 120,912,519 (+) Ensembl GRCm39 Ensembl GRCm38 4 121,039,566 - 121,055,325 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 121,039,385 - 121,055,322 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 120,712,171 - 120,727,930 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 120,536,967 - 120,552,936 (+) NCBI MGSCv36 mm8 Celera 4 119,750,556 - 119,766,271 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 56.78 NCBI
Col9a2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 139,481 - 153,567 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 139,481 - 152,866 (-) NCBI ChiLan1.0 ChiLan1.0
COL9A2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 186,498,969 - 186,516,221 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 185,636,576 - 185,653,834 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 39,596,050 - 39,613,316 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 40,918,814 - 40,935,953 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 40,918,814 - 40,935,953 (-) Ensembl panpan1.1 panPan2
COL9A2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 2,615,428 - 2,661,552 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 2,646,982 - 2,661,552 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 2,904,860 - 2,919,446 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 2,733,779 - 2,748,412 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 2,733,754 - 2,748,789 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 2,641,314 - 2,655,909 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 2,701,522 - 2,716,112 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 2,717,552 - 2,732,160 (+) NCBI UU_Cfam_GSD_1.0
Col9a2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 56,256,890 - 56,271,201 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 22,081,858 - 22,095,921 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 22,081,672 - 22,095,997 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COL9A2
COL9A2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 92,582,167 - 92,599,151 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 92,582,736 - 92,599,423 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 24,280,126 - 24,297,147 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Col9a2
.
Predicted Target Of
Count of predictions: 74 Count of miRNA genes: 61 Interacting mature miRNAs: 66 Transcripts: ENSRNOT00000048506 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Col9a2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 134,623,139 - 134,623,328 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,978,327 - 139,978,515 NCBI Rnor6.0 Rnor_5.0 5 143,771,768 - 143,771,956 UniSTS Rnor5.0 RGSC_v3.4 5 141,638,687 - 141,638,875 UniSTS RGSC3.4 Celera 5 133,176,857 - 133,177,045 UniSTS Cytogenetic Map 5 q36 UniSTS
RH137202
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 134,624,378 - 134,624,566 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,979,566 - 139,979,753 NCBI Rnor6.0 Rnor_5.0 5 143,773,007 - 143,773,194 UniSTS Rnor5.0 RGSC_v3.4 5 141,639,926 - 141,640,113 UniSTS RGSC3.4 Celera 5 133,178,096 - 133,178,283 UniSTS RH 3.4 Map 5 890.1 UniSTS Cytogenetic Map 5 q36 UniSTS
UniSTS:478965
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
113
87
86
55
25
55
6
210
93
93
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048506 ⟹ ENSRNOP00000049994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 134,607,616 - 134,624,677 (+) Ensembl Rnor_6.0 Ensembl 5 139,963,002 - 139,979,864 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096235 ⟹ ENSRNOP00000084283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 134,608,447 - 134,624,677 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104027 ⟹ ENSRNOP00000089485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 134,607,616 - 134,624,677 (+) Ensembl
RefSeq Acc Id:
NM_001108675 ⟹ NP_001102145
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,892,798 - 139,909,855 (+) NCBI mRatBN7.2 5 134,607,616 - 134,624,677 (+) NCBI Rnor_6.0 5 139,963,002 - 139,979,864 (+) NCBI Rnor_5.0 5 143,756,118 - 143,773,306 (+) NCBI RGSC_v3.4 5 141,623,365 - 141,640,224 (+) RGD Celera 5 133,161,241 - 133,178,394 (+) RGD
Sequence:
AAGGACCCAGACAAGCCTGCCCCAGACCTGAGGAAAAGATGAGGCTGAGGACCAGGAGGAGAGTTGGATCCTGGAGGGCAAGGGGGAAAGGGTCTTTGGATGGCTTTCTGCTCTCCACAGAGAAAGTG
hide sequence
RefSeq Acc Id:
XM_039110306 ⟹ XP_038966234
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,898,276 - 139,910,131 (+) NCBI mRatBN7.2 5 134,613,092 - 134,624,678 (+) NCBI
RefSeq Acc Id:
NP_001102145 ⟸ NM_001108675
- Peptide Label:
precursor
- UniProtKB:
D3ZNT5 (UniProtKB/TrEMBL), A6IS03 (UniProtKB/TrEMBL)
- Sequence:
MTALPAPRSLLLFLQVLWLALAQIRGPPGEPGLPGPPGPPGVPGSDGIDGDKGPPGKVGPPGSKGEPGKPGPDGPDGKPGIDGLMGAKGEPGPMGTPGIKGQPGLPGPPGLPGPGFAGPPGPPGPVGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000049994 ⟸ ENSRNOT00000048506
RefSeq Acc Id:
XP_038966234 ⟸ XM_039110306
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000089485 ⟸ ENSRNOT00000104027
Ensembl Acc Id:
ENSRNOP00000084283 ⟸ ENSRNOT00000096235
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-27
Col9a2
collagen type IX alpha 2 chain
Col9a2
collagen, type IX, alpha 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-25
Col9a2
collagen, type IX, alpha 2
Col9a2_predicted
procollagen, type IX, alpha 2 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Col9a2_predicted
procollagen, type IX, alpha 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
