Advanced Search (OLGA)

Gene: Cyc1 (cytochrome c-1) Rattus norvegicus

Analyze

Symbol:

Cyc1

Name:

cytochrome c-1

RGD ID:

1306597

Description:

Predicted to enable electron transfer activity; heme binding activity; and metal ion binding activity. Involved in response to glucagon. Predicted to be located in mitochondrial inner membrane. Predicted to be part of respiratory chain complex III. Human ortholog(s) of this gene implicated in mitochondrial complex III deficiency nuclear type 6. Orthologous to human CYC1 (cytochrome c1); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 17beta-estradiol; 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC300047

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CYC1 (cytochrome c1)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Cyc1 (cytochrome c-1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	LOC102023109 (cytochrome c1, heme protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100995886 (cytochrome c1, heme protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CYC1 (cytochrome c1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101954680 (cytochrome c1, heme protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CYC1 (cytochrome c1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103237609 (cytochrome c1, heme protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	LOC101700825 (cytochrome c1, heme protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CYC1 (cytochrome c1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cyc1 (cytochrome c-1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cyc1 (cytochrome c-1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CYT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cyt-c1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cyt-c1L	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Cyc1-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	109,947,750 - 109,950,142 (+)	NCBI		GRCr8
mRatBN7.2	7	108,067,106 - 108,069,483 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,067,115 - 108,069,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	109,810,759 - 109,813,136 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,034,453 - 112,036,830 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	111,992,914 - 111,995,283 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	117,409,576 - 117,411,953 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	117,409,576 - 117,411,953 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	117,397,206 - 117,399,583 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	114,394,178 - 114,396,563 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	114,428,409 - 114,430,788 (+)	NCBI
Celera	7	104,419,433 - 104,421,810 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brown-Vialetto-Van Laere syndrome 2 (ISO)

epidermolysis bullosa simplex with muscular dystrophy (ISO)

holoprosencephaly (ISO)

mitochondrial complex III deficiency nuclear type 1 (ISO)

mitochondrial complex III deficiency nuclear type 6 (ISO)

Recombinant Chromosome 8 Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

geraniol (ISO)

guggulsterone (ISO)

ivermectin (ISO)

L-methionine (ISO)

maneb (ISO)

methimazole (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N,N-diethyl-m-toluamide (EXP)

nitrates (ISO)

ouabain (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

permethrin (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

probenecid (ISO)

Pyridostigmine bromide (EXP)

resveratrol (ISO)

rotenone (ISO)

sarin (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

streptozocin (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

thioacetamide (ISO)

thiram (ISO)

tolcapone (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial electron transport, ubiquinol to cytochrome c (IBA)

response to glucagon (IDA)

Cellular Component

mitochondrial inner membrane (ISO)

mitochondrion (ISO)

respiratory chain complex III (IBA,ISO)

Molecular Function

electron transfer activity (IEA)

heme binding (IEA)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Alzheimer's disease pathway (IEA)

Huntington's disease pathway (IEA)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Stimulation of the respiratory chain of rat liver mitochondria between cytochrome c1 and cytochrome c by glucagon treatment of rats.	Halestrap AP Biochem J. 1978 Jun 15;172(3):399-405.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:12865426	PMID:14651853	PMID:18614015	PMID:19946888	PMID:20833797	PMID:21630459	PMID:23093945	PMID:28844695

Genomics

Comparative Map Data

Cyc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	109,947,750 - 109,950,142 (+)	NCBI		GRCr8
mRatBN7.2	7	108,067,106 - 108,069,483 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	108,067,115 - 108,069,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	109,810,759 - 109,813,136 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	112,034,453 - 112,036,830 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	111,992,914 - 111,995,283 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	117,409,576 - 117,411,953 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	117,409,576 - 117,411,953 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	117,397,206 - 117,399,583 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	114,394,178 - 114,396,563 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	114,428,409 - 114,430,788 (+)	NCBI
Celera	7	104,419,433 - 104,421,810 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

CYC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	144,095,076 - 144,097,525 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	144,095,039 - 144,097,525 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	145,149,979 - 145,152,428 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	145,221,948 - 145,224,416 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	145,221,986 - 145,224,415	NCBI
Celera	8	141,487,538 - 141,489,945 (+)	NCBI		Celera
Cytogenetic Map	8	q24.3	NCBI
HuRef	8	140,425,864 - 140,428,305 (+)	NCBI		HuRef
CHM1_1	8	145,190,195 - 145,192,636 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	145,255,893 - 145,258,315 (+)	NCBI		T2T-CHM13v2.0

Cyc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	76,227,711 - 76,230,460 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	76,227,723 - 76,230,460 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	76,343,513 - 76,346,260 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	76,343,523 - 76,346,260 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	76,173,953 - 76,176,364 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	76,170,778 - 76,173,189 (+)	NCBI		MGSCv36	mm8
Celera	15	77,843,584 - 77,845,995 (+)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	35.74	NCBI

LOC102023109
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	2,758,292 - 2,760,376 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	2,758,935 - 2,760,569 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100995886
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	161,584,643 - 161,587,163 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	137,114,566 - 137,117,043 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	140,861,432 - 140,863,900 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	143,853,354 - 143,855,847 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	143,853,354 - 143,855,847 (+)	Ensembl	panpan1.1		panPan2

CYC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	37,590,919 - 37,593,239 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	37,590,912 - 37,593,156 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	37,554,629 - 37,556,933 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	38,067,159 - 38,069,463 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	38,053,345 - 38,069,424 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	37,739,217 - 37,741,521 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	37,867,897 - 37,870,201 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	38,344,074 - 38,346,378 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101954680
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	656,692 - 659,079 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	8,082,791 - 8,085,185 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	8,082,791 - 8,085,197 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CYC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	606,516 - 608,996 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	606,510 - 608,991 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	759,649 - 762,119 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103237609
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	138,307,537 - 138,310,037 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	138,307,581 - 138,312,915 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	1,562,941 - 1,565,856 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101700825
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	12,724,670 - 12,727,120 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	12,724,670 - 12,727,035 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cyc1
27 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	47
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000017067
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

RH125823

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	108,069,253 - 108,069,472 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	117,411,724 - 117,411,942	NCBI	Rnor6.0
Rnor_5.0	7	117,399,354 - 117,399,572	UniSTS	Rnor5.0
RGSC_v3.4	7	114,396,335 - 114,396,553	UniSTS	RGSC3.4
Celera	7	104,421,581 - 104,421,799	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH138711

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	109,947,780 - 109,948,529 (+)	Marker Load Pipeline
mRatBN7.2	7	108,067,121 - 108,067,870 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	117,409,592 - 117,410,340	NCBI	Rnor6.0
Rnor_5.0	7	117,397,222 - 117,397,970	UniSTS	Rnor5.0
RGSC_v3.4	7	114,394,203 - 114,394,951	UniSTS	RGSC3.4
Celera	7	104,419,449 - 104,420,197	UniSTS
RH 3.4 Map	2	1611.31	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001277194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM122421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FN801980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017067 ⟹ ENSRNOP00000017067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	108,067,115 - 108,069,479 (+)	Ensembl
Rnor_6.0 Ensembl	7	117,409,576 - 117,411,953 (+)	Ensembl

RefSeq Acc Id:

NM_001277194 ⟹ NP_001264123

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	109,947,765 - 109,950,142 (+)	NCBI
mRatBN7.2	7	108,067,106 - 108,069,483 (+)	NCBI
Rnor_6.0	7	117,409,576 - 117,411,953 (+)	NCBI
Rnor_5.0	7	117,397,206 - 117,399,583 (+)	NCBI
Celera	7	104,419,433 - 104,421,810 (+)	NCBI

Sequence:

show sequence

GACGGGAACGGCGGCCGCACTAAAGAGGGCCGACATGGCGGCGGCGGCGGCGGCTTCGCTTCGC
CGATCGGTGCTAGGCCCGCGGGGCATGGGGCTTCCAGGTGCAAGTGCTCCGGGCCTGCTGGGCG
GCGCGCGGCCCCGGCATCTTCCATTACGGACACCGCAGGCAGTGTCCTTGTCCTCGAAGTCTGG
CCCTTCTCGAGGCCGAAAGGTGATGCTGTCAGCGTTGGGCATGCTGGCAGCAGGGGGTGCAGGG
CTAGCTGTGGCCCTTCATTCGGCGGTGAGTGCCAGTGACCTGGAGCTGCACCCCCCCAGCTACC
CATGGTCTCACCGTGGCCTCCTCTCCTCCTTGGACCACACCAGCATTCGTAGGGGTTTCCAGGT
ATACAAGCAGGTGTGCTCTTCCTGCCACAGCATGGATTATGTGGCTTACCGCCACCTGGTGGGA
GTGTGCTACACGGAGGAAGAAGCTAAGGCGCTGGCTGAGGAGGTGGAGGTCCAGGATGGCCCTA
ATGAGGATGGGAATATGTTCATGCGGCCAGGGAAGCTGTCTGACTATTTTCCAAAACCATACCC
CAACCCTGAGGCTGCAAGAGCTGCTAACAATGGAGCTTTACCCCCTGACCTCAGCTACATCGTT
CGAGCAAGGCACGGTGGTGAGGACTATGTGTTTTCCTTGCTCACTGGCTACTGTGAACCTCCCA
CTGGGGTGTCATTGCGAGAAGGCCTCTATTTCAACCCTTACTTTCCTGGCCAGGCCATTGGCAT
GGCTCCTCCCATCTACACAGAAGTCTTGGAGTATGACGATGGTACCCCAGCTACCATGTCACAA
GTAGCCAAGGATGTTGCCACCTTCCTTCGCTGGGCATCAGAGCCAGAGCATGACCATCGAAAAC
GCATGGGACTCAAGATGTTGTTGATGATGGGCTTGCTGCTGCCCCTGACCTATGCCATGAAGCG
GCATAAGTGGTCAGTCCTGAAGAGTCGAAAGCTGGCTTATCGGCCACCCAAGTGACCCTGTTCA
GTATCTGCTTGTCATCTTGCCTGAACAAGCTCTCAGCAGACCAGGAACAGTCCGAGGCCTTTCA
GGCCTGGCCCCTTTTCATCAGATACCAGGGCCAGGAGACCAGACTCTTGCTTCTGATCTTCCTT
TAGCCTTCATTGTGGGAATAAATTAAGTTTCTCAACACACACA

hide sequence

RefSeq Acc Id:

XM_063263310 ⟹ XP_063119380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	109,947,750 - 109,950,138 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001264123	(Get FASTA)	NCBI Sequence Viewer
	XP_063119380	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15987	(Get FASTA)	NCBI Sequence Viewer
	EDM15988	(Get FASTA)	NCBI Sequence Viewer
	EDM15989	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017067.7

RefSeq Acc Id:

NP_001264123 ⟸ NM_001277194

- UniProtKB:

A6HS83 (UniProtKB/TrEMBL), D3ZFQ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAAAASLRRSVLGPRGMGLPGASAPGLLGGARPRHLPLRTPQAVSLSSKSGPSRGRKVMLSA
LGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSM
DYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGNMFMRPGKLSDYFPKPYPNPEAARAANNG
ALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY
DDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKL
AYRPPK

hide sequence

Ensembl Acc Id:

ENSRNOP00000017067 ⟸ ENSRNOT00000017067

RefSeq Acc Id:	XP_063119380 ⟸ XM_063263310
- Peptide Label:	isoform X1
- UniProtKB:	D3ZFQ8 (UniProtKB/TrEMBL)

Protein Domains

Cytochrome c

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZFQ8-F1-model_v2	AlphaFold	D3ZFQ8	1-326	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695415

Promoter ID:

EPDNEW_R5939

Type:

multiple initiation site

Name:

Cyc1_1

Description:

cytochrome c-1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	117,409,594 - 117,409,654	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306597	AgrOrtholog
BioCyc Gene	G2FUF-32937	BioCyc
Ensembl Genes	ENSRNOG00000012457	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017067.8	UniProtKB/TrEMBL
Gene3D-CATH	1.10.760.10	UniProtKB/TrEMBL
	Cytochrome c1, transmembrane anchor, C-terminal	UniProtKB/TrEMBL
InterPro	Cyt_c-like_dom	UniProtKB/TrEMBL
	Cyt_c-like_dom_sf	UniProtKB/TrEMBL
	Cyt_c1	UniProtKB/TrEMBL
	Cyt_c1_TM_anchor_C	UniProtKB/TrEMBL
KEGG Report	rno:300047	UniProtKB/TrEMBL
NCBI Gene	300047	ENTREZGENE
PANTHER	Cyt_C1	UniProtKB/TrEMBL
	CYTOCHROME C1, HEME PROTEIN, MITOCHONDRIAL	UniProtKB/TrEMBL
Pfam	Cytochrom_C1	UniProtKB/TrEMBL
PhenoGen	Cyc1	PhenoGen
PRINTS	CYTOCHROMEC1	UniProtKB/TrEMBL
PROSITE	CYTC	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012457	RatGTEx
Superfamily-SCOP	SSF46626	UniProtKB/TrEMBL
	SSF81496	UniProtKB/TrEMBL
UniProt	A6HS83	ENTREZGENE, UniProtKB/TrEMBL
	D3ZFQ8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Cyc1	cytochrome c-1	Cyc1_predicted	cytochrome c-1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Cyc1_predicted	cytochrome c-1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)