Advanced Search (OLGA)

Gene: Tmem86a (transmembrane protein 86A) Rattus norvegicus

Analyze

Symbol:

Tmem86a

Name:

transmembrane protein 86A

RGD ID:

1305749

Description:

Predicted to enable alkenylglycerophosphocholine hydrolase activity. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in membrane. Orthologous to human TMEM86A (transmembrane protein 86A); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC308602; lysoplasmalogenase TMEM86A; lysoplasmalogenase-like protein TMEM86A; RGD1305749; similar to RIKEN cDNA 1810054O13

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM86A (transmembrane protein 86A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Tmem86a (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem86a (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM86A (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM86A (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem86a (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM86A (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM86A (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem86a (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tmem86a (transmembrane protein 86A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TVP23B (trans-golgi network vesicle protein 23 homolog B)	HGNC	OMA
Homo sapiens (human):	TVP23C (trans-golgi network vesicle protein 23 homolog C)	HGNC	OMA
Homo sapiens (human):	TVP23C-CDRT4 (TVP23C-CDRT4 readthrough)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tmem86a (transmembrane protein 86A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMEM86A (transmembrane protein 86A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem86a (transmembrane protein 86A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	M176.4	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	M176.4	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG7582	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem86a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem86a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	106,732,168 - 106,736,518 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	106,661,042 - 106,736,516 (+)	Ensembl				GRCr8
mRatBN7.2	1	97,595,910 - 97,600,260 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	97,595,842 - 97,600,260 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	102,985,892 - 102,990,237 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	111,457,875 - 111,462,220 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	104,744,246 - 104,748,596 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	103,173,032 - 103,177,382 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	103,172,987 - 103,177,417 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	104,238,667 - 104,243,017 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	97,604,511 - 97,608,861 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	91,840,910 - 91,845,260 (+)	NCBI		Celera
RGSC_v3.1	1	97,646,872 - 97,686,055 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

choline (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

fluoranthene (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

indometacin (ISO)

inulin (ISO)

iron atom (EXP)

iron dichloride (ISO)

iron(0) (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

organophosphorus compound (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

propanal (ISO)

rac-lactic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

endoplasmic reticulum membrane (ISO)

membrane (IBA,IEA)

Molecular Function

alkenylglycerophosphocholine hydrolase activity (ISO)

hydrolase activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:15632090

Genomics

Comparative Map Data

Tmem86a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	106,732,168 - 106,736,518 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	106,661,042 - 106,736,516 (+)	Ensembl				GRCr8
mRatBN7.2	1	97,595,910 - 97,600,260 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	97,595,842 - 97,600,260 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	102,985,892 - 102,990,237 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	111,457,875 - 111,462,220 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	104,744,246 - 104,748,596 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	103,173,032 - 103,177,382 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	103,172,987 - 103,177,417 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	104,238,667 - 104,243,017 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	97,604,511 - 97,608,861 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	91,840,910 - 91,845,260 (+)	NCBI		Celera
RGSC_v3.1	1	97,646,872 - 97,686,055 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

TMEM86A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	18,698,779 - 18,704,785 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	18,693,122 - 18,704,785 (+)	Ensembl			hg38	GRCh38
GRCh37	11	18,720,326 - 18,726,332 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	18,676,927 - 18,682,908 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	11	18,856,213 - 18,862,194 (+)	NCBI		Celera
Cytogenetic Map	11	p15.1	NCBI
HuRef	11	18,405,272 - 18,411,253 (+)	NCBI		HuRef
CHM1_1	11	18,719,688 - 18,725,669 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	18,796,841 - 18,802,847 (+)	NCBI		T2T-CHM13v2.0

Tmem86a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	46,700,388 - 46,704,524 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	46,700,349 - 46,704,525 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	47,050,640 - 47,054,776 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	47,050,601 - 47,054,777 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	54,306,010 - 54,310,146 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	46,918,662 - 46,922,798 (+)	NCBI		MGSCv36	mm8
Celera	7	42,532,925 - 42,537,050 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	30.68	NCBI

Tmem86a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	33,357,383 - 33,361,478 (+)	Ensembl
ChiLan1.0	NW_004955414	33,357,432 - 33,361,478 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMEM86A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	21,008,223 - 21,018,734 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	20,968,748 - 20,979,130 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	18,729,053 - 18,739,491 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	18,643,548 - 18,650,206 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	18,643,548 - 18,650,206 (+)	Ensembl			panPan2	panpan1.1

TMEM86A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	41,070,627 - 41,074,870 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	41,070,581 - 41,073,937 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	40,549,503 - 40,553,717 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	42,193,683 - 42,197,897 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	42,193,629 - 42,197,874 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	41,196,773 - 41,200,985 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	41,373,842 - 41,378,078 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	41,751,515 - 41,755,729 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tmem86a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	44,576,341 - 44,580,729 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936528	609,973 - 614,735 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936528	610,321 - 614,685 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM86A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	40,545,776 - 40,550,843 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	40,545,773 - 40,550,838 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	43,555,008 - 43,560,049 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM86A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	46,220,818 - 46,227,848 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	46,224,426 - 46,227,727 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	143,560,105 - 143,569,087 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem86a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	10,120,479 - 10,123,228 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624766	10,119,453 - 10,124,403 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tmem86a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	152,320,374 - 152,324,438 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tmem86a
25 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	85
Interacting mature miRNAs:	90
Transcripts:	ENSRNOT00000018688
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

AW742698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	97,599,983 - 97,600,231 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	103,177,106 - 103,177,353	NCBI	Rnor6.0
Rnor_5.0	1	104,242,741 - 104,242,988	UniSTS	Rnor5.0
RGSC_v3.4	1	97,608,585 - 97,608,832	UniSTS	RGSC3.4
Celera	1	91,844,984 - 91,845,231	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH133172

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	97,600,675 - 97,600,895 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	103,177,798 - 103,178,017	NCBI	Rnor6.0
Rnor_5.0	1	104,243,433 - 104,243,652	UniSTS	Rnor5.0
RGSC_v3.4	1	97,609,277 - 97,609,496	UniSTS	RGSC3.4
Celera	1	91,845,676 - 91,845,895	UniSTS
RH 3.4 Map	1	910.29	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH134382

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	97,600,004 - 97,600,198 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	103,177,127 - 103,177,320	NCBI	Rnor6.0
Rnor_5.0	1	104,242,762 - 104,242,955	UniSTS	Rnor5.0
RGSC_v3.4	1	97,608,606 - 97,608,799	UniSTS	RGSC3.4
Celera	1	91,845,005 - 91,845,198	UniSTS
RH 3.4 Map	1	909.9	UniSTS
Cytogenetic Map	1	q22	UniSTS

BE102385

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	97,591,067 - 97,591,234 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	103,168,190 - 103,168,356	NCBI	Rnor6.0
Rnor_5.0	1	104,233,825 - 104,233,991	UniSTS	Rnor5.0
RGSC_v3.4	1	97,599,669 - 97,599,835	UniSTS	RGSC3.4
Celera	1	91,836,068 - 91,836,234	UniSTS
RH 3.4 Map	1	909.51	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH140718

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	97,598,021 - 97,598,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	103,175,143 - 103,175,378	NCBI	Rnor6.0
Rnor_5.0	1	104,240,778 - 104,241,013	UniSTS	Rnor5.0
RGSC_v3.4	1	97,606,622 - 97,606,857	UniSTS	RGSC3.4
Celera	1	91,843,021 - 91,843,256	UniSTS
RH 3.4 Map	1	910.8	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	91	59	6	355	191	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA924203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BE100466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BE109619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO395066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018688 ⟹ ENSRNOP00000018688

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	106,732,103 - 106,736,490 (+)	Ensembl
mRatBN7.2 Ensembl	1	97,595,842 - 97,600,260 (+)	Ensembl
Rnor_6.0 Ensembl	1	103,172,987 - 103,177,417 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127183 ⟹ ENSRNOP00000109811

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	106,661,042 - 106,736,516 (+)	Ensembl

RefSeq Acc Id:

NM_001135016 ⟹ NP_001128488

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	106,732,168 - 106,736,518 (+)	NCBI
mRatBN7.2	1	97,595,910 - 97,600,260 (+)	NCBI
Rnor_6.0	1	103,173,032 - 103,177,382 (+)	NCBI
Rnor_5.0	1	104,238,667 - 104,243,017 (+)	NCBI
RGSC_v3.4	1	97,604,511 - 97,608,861 (+)	RGD
Celera	1	91,840,910 - 91,845,260 (+)	RGD

Sequence:

show sequence

CAGCTTTGTTCAGTCGTCTGCTCACCTAGCTCTGGGTGCGTCCTGGCGGTGCAACCCGGAGCGG
GTGCCAGCAGCAGCAGCCGCCGCCGCCATGGTGTCTCCGGTCACTGTGGTGAAGAGCGAGGGGC
CCAAGCTGGTGCCCTTCTTTAAGGCTACCTGTGTGTATTTCGTGCTCTGGCTGCCCTCCTCCAG
CCCATCCTGGTTCAGCGCCCTTATCAAGTGCCTGCCCATCTTCTGCCTCTGGCTTTTTCTTCTG
GCCCATGGCTTTCGATTCCTGCTGGCCCACCCCAGTGCCTCCCTCATCTTTGCGGGACTCGTCT
TCTCCGCTGTGGGCGATGCCTTCCTCATCTGGCAGGACTCCGGATACTTTGAACATGGTCTCCT
GATGTTTGCTGTGGCACACATACTCTATGCCTTGGCCTTTGGCATGCGGCCGCTGGCTCTTCGG
ACAGGCCTGGTGATCGGAGTGCTGTCAGGCCTGTGCTATGCCCTCCTCTACCCGAGGCTGTCAG
GTGCTTTCACCTACCTAGTGGGGGTCTACGTGACCCTTATCAGCTTCATGGGCTGGAGGGCTAT
GGCAGGGCTGCGGCTGGGTGGGGCAGCCTGGCGGTGGACAGAGCTGGCAGCCGGTGTCGGCGCT
CTGCTTTTCATCCTCTCCGACCTGACCATCGCCCTCAACAAGTTCTGCTTCCCCGTGCCCTACT
CCCGAGCCCTCATCATGTCCACTTATTATGCTGCTCAGATGTTCATCGCCCTGTCGGCCGTCGA
GAGCCGGGAGCCGGTGGAAGACTACAGGCTGAGCAAGGCCGCCTGAGGGGACTCGGGTCTGCTC
AGCTTTCTCCTGCGGCTGGGGCCCAGATTTTGGGAGTGTGCAGGCCCTGGATCAGCAGGCAGCT
TCTGGGAAAGGTGGCAGGCTTGAAGGGGGAGGGAGGGTAGGCTGAAGGAGCTCCTGGGAAAGCT
GGTAGTCCAGGATGACCCAGAGAGCTCAAAGATGCAGCCTCATATCCCTCACCTGATCAGAGGT
AGACATCCCCTCACCCCATCAGGACTAGCAAAGCCCTCCTGGAAGGTGATGGTGCTTTTTGACC
CCTCTGTTTTTTCTAGATGCAAGAGTGTGGCTATCTCTTATGTCCAGGACCAATGGCAATGTCA
GGCCCCTCCATTCCCACCTTTTCTCCTCCAATATGACCCACGGACAAGCAGGCTTGAAAAGCTC
TTTCCCCAGGCTCCCCAACTGGGAAGACTGGTTGAAGGTGGAGTCTTGTCTTCTGTGTCCAGCC
TTGTGGCTTGAAGTCTTTTAAGTGGTGAATGGGTGTCCATGAGAAGTAGTAGAGGGCACTTTGT
TGGACTGGAAGCTTGAGGGTACCATGGTTTCAGATGGGTCATTTTTCTCTCACCCTCGTTCCAT
CACCCTCAGCCTCTGTCCCCAGGGCTAGGGTGGACCATGCCAAAGGAAGGGGCCAGTCTCCAGC
TATATGACTTTGTCCTGCTGTCTGCAAAAGACTTAAAGTGGCAGGCCTCAGAGAGCTCCTGAGG
GGTGCTTAACCTGGCTGGGAGCTGGGGCCCTCCCCTAGCCCACCAACAATGCTTTCTTCCTGCT
CTGGGAGTGAGTTCTAAATGACACTTTAGGGTCTTAAGACCCGAGGCACAGTCAATGCAAGCGG
AGTAAGGATGGGGTAACTCCATCCTCTACTGCCCATGTGAAAAAAATAAAATTAAATTAAAACC
CAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128488	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07241	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018688
	ENSRNOP00000018688.5
	ENSRNOP00000109811.1

RefSeq Acc Id:

NP_001128488 ⟸ NM_001135016

- UniProtKB:

D3ZI62 (UniProtKB/TrEMBL), A6JBE3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWFSALIKCLPIFCLWLFLLAHGFRFLLA
HPSASLIFAGLVFSAVGDAFLIWQDSGYFEHGLLMFAVAHILYALAFGMRPLALRTGLVIGVLS
GLCYALLYPRLSGAFTYLVGVYVTLISFMGWRAMAGLRLGGAAWRWTELAAGVGALLFILSDLT
IALNKFCFPVPYSRALIMSTYYAAQMFIALSAVESREPVEDYRLSKAA

hide sequence

Ensembl Acc Id:

ENSRNOP00000018688 ⟸ ENSRNOT00000018688

Ensembl Acc Id:

ENSRNOP00000109811 ⟸ ENSRNOT00000127183

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZI62-F1-model_v2	AlphaFold	D3ZI62	1-240	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690073

Promoter ID:

EPDNEW_R598

Type:

initiation region

Name:

Tmem86a_1

Description:

transmembrane protein 86A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	103,173,014 - 103,173,074	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305749	AgrOrtholog
BioCyc Gene	G2FUF-59597	BioCyc
Ensembl Genes	ENSRNOG00000013663	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018688	ENTREZGENE
	ENSRNOT00000018688.8	UniProtKB/TrEMBL
	ENSRNOT00000127183.1	UniProtKB/TrEMBL
InterPro	YhhN	UniProtKB/TrEMBL
KEGG Report	rno:308602	UniProtKB/TrEMBL
NCBI Gene	308602	ENTREZGENE
PANTHER	LYSOPLASMALOGENASE-LIKE PROTEIN TMEM86A	UniProtKB/TrEMBL
	PTHR31885	UniProtKB/TrEMBL
Pfam	YhhN	UniProtKB/TrEMBL
PhenoGen	Tmem86a	PhenoGen
RatGTEx	ENSRNOG00000013663	RatGTEx
UniProt	A0ABK0LWA1_RAT	UniProtKB/TrEMBL
	A6JBE3	ENTREZGENE, UniProtKB/TrEMBL
	D3ZI62	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Tmem86a	transmembrane protein 86A	Tmem86a_predicted	transmembrane protein 86A (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Tmem86a_predicted	transmembrane protein 86A (predicted)	RGD1305749_predicted	similar to RIKEN cDNA 1810054O13 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1305749_predicted	similar to RIKEN cDNA 1810054O13 (predicted)	LOC308602_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC308602_predicted	similar to RIKEN cDNA 1810054O13 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message