Advanced Search (OLGA)

Gene: Adtrp (androgen-dependent TFPI-regulating protein) Rattus norvegicus

Analyze

Symbol:

Adtrp

Name:

androgen-dependent TFPI-regulating protein

RGD ID:

1305679

Description:

Predicted to enable hydrolase activity. Predicted to be involved in several processes, including cell migration involved in sprouting angiogenesis; cellular response to oxidised low-density lipoprotein particle stimulus; and negative regulation of secretion by cell. Predicted to be located in caveola and cell surface. Predicted to be active in endomembrane system. Orthologous to human ADTRP (androgen dependent TFPI regulating protein); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Aa2-020; androgen-dependent TPF1-regulating protein; FAHFA hydrolase ADTRP; fatty acid esters of hydroxy fatty acids hydrolase ADTRP; hypothetical protein LOC361228; liver regeneration-related protein LRRG140; LOC361228; RGD1305679; similar to 9530008L14Rik protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADTRP (androgen dependent TFPI regulating protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Adtrp (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Adtrp (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADTRP (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADTRP (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adtrp (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADTRP (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADTRP (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adtrp (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Adtrp (androgen dependent TFPI regulating protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FRAS1 (Fraser extracellular matrix complex subunit 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ADTRP (androgen dependent TFPI regulating protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADTRP (androgen dependent TFPI regulating protein)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adtrp (androgen dependent TFPI regulating protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adtrp (androgen dependent TFPI regulating protein)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C37E2.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C37E2.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11601	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG11601	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3625	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG3625	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6149	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG6149	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YHR140W	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	YHR140W	Alliance	DIOPT (Hieranoid\|PANTHER)
Danio rerio (zebrafish):	adtrp1	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C37E2.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C37E2.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adtrp	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	23,113,578 - 23,199,616 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	23,135,809 - 23,216,622 (+)	Ensembl				GRCr8
mRatBN7.2	17	22,907,758 - 22,993,834 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	22,930,740 - 22,993,826 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	22,782,697 - 22,868,861 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	24,386,378 - 24,472,529 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	22,717,160 - 22,803,208 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	22,619,913 - 22,688,296 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	22,619,891 - 22,688,307 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	24,597,532 - 24,662,658 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	28,815,650 - 28,879,571 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	22,604,529 - 22,667,496 (+)	NCBI		Celera
RGSC_v3.1	17	28,818,490 - 28,882,411 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

coronary artery disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4,5,3',4',5'-Hexachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

9-hydroxyoctadecanoic acid (ISO)

acetamide (EXP)

amiodarone (EXP)

atrazine (EXP)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diallyl disulfide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

endosulfan (EXP)

flutamide (EXP)

formaldehyde (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (EXP)

gentamycin (EXP)

glafenine (EXP)

GW 4064 (ISO)

hydroquinone (ISO)

isotretinoin (ISO)

L-ethionine (EXP)

lead diacetate (ISO)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

nicotine (ISO)

nitrofen (EXP)

okadaic acid (ISO)

omeprazole (EXP)

p-toluidine (EXP)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (EXP)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

troglitazone (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration involved in sprouting angiogenesis (IEA,ISO)

cellular response to oxidised low-density lipoprotein particle stimulus (IEA,ISO)

cellular response to steroid hormone stimulus (IEA,ISO)

lipid metabolic process (IEA)

long-chain fatty acid catabolic process (IEA,ISO)

negative regulation of blood coagulation (IEA,ISO)

negative regulation of extracellular matrix constituent secretion (IEA,ISO)

negative regulation of leukocyte cell-cell adhesion (IEA,ISO)

negative regulation of leukocyte migration (IEA,ISO)

negative regulation of lymphocyte migration (IEA,ISO)

negative regulation of protein secretion (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO)

Cellular Component

caveola (IEA,ISO)

cell surface (IEA,ISO)

endomembrane system (IBA,IEA)

membrane (IEA,ISO)

plasma membrane (IEA)

Molecular Function

hydrolase activity (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:21868574	PMID:27018888	PMID:28341552

Genomics

Comparative Map Data

Adtrp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	23,113,578 - 23,199,616 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	23,135,809 - 23,216,622 (+)	Ensembl				GRCr8
mRatBN7.2	17	22,907,758 - 22,993,834 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	22,930,740 - 22,993,826 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	22,782,697 - 22,868,861 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	24,386,378 - 24,472,529 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	22,717,160 - 22,803,208 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	22,619,913 - 22,688,296 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	22,619,891 - 22,688,307 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	24,597,532 - 24,662,658 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	28,815,650 - 28,879,571 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	22,604,529 - 22,667,496 (+)	NCBI		Celera
RGSC_v3.1	17	28,818,490 - 28,882,411 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

ADTRP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	11,713,523 - 11,778,803 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	11,712,054 - 11,807,046 (-)	Ensembl			hg38	GRCh38
GRCh37	6	11,713,756 - 11,779,036 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	11,821,895 - 11,887,052 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	11,821,894 - 11,887,052	NCBI
Celera	6	12,941,888 - 13,007,296 (-)	NCBI		Celera
Cytogenetic Map	6	p24.1	NCBI
HuRef	6	11,645,931 - 11,711,306 (-)	NCBI		HuRef
CHM1_1	6	11,716,021 - 11,781,371 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	11,581,768 - 11,675,389 (-)	NCBI		T2T-CHM13v2.0

Adtrp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	41,916,621 - 42,001,092 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	41,916,624 - 42,001,160 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	41,763,145 - 41,847,616 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	41,763,148 - 41,847,684 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	41,858,517 - 41,942,985 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	41,774,122 - 41,858,462 (-)	NCBI		MGSCv36	mm8
Celera	13	42,843,698 - 42,926,413 (-)	NCBI		Celera
Cytogenetic Map	13	A4	NCBI
cM Map	13	20.61	NCBI

Adtrp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	2,742,169 - 2,809,790 (+)	Ensembl
ChiLan1.0	NW_004955465	2,721,171 - 2,823,368 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADTRP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	26,359,072 - 26,430,399 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	22,349,346 - 22,420,599 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	11,550,584 - 11,648,755 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	11,829,782 - 11,895,656 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	11,829,782 - 11,895,656 (-)	Ensembl			panPan2	panpan1.1

ADTRP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	11,300,186 - 11,362,893 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	11,300,887 - 11,362,101 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	11,251,953 - 11,314,604 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	11,405,929 - 11,467,996 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	11,406,525 - 11,468,000 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	11,235,206 - 11,297,780 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	11,284,005 - 11,346,710 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	12,608,632 - 12,671,260 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Adtrp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	13,063,146 - 13,119,309 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	1,332,625 - 1,389,572 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936534	1,332,682 - 1,389,242 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADTRP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	8,243,371 - 8,313,648 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	8,242,770 - 8,313,684 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	8,566,929 - 8,644,961 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADTRP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	60,371,412 - 60,436,988 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	60,368,546 - 60,438,864 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	11,738,513 - 11,805,652 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adtrp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	14,290,028 - 14,354,284 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624756	14,289,144 - 14,354,999 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Adtrp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	60,753,490 - 60,816,169 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Adtrp
573 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	53
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000019478, ENSRNOT00000060403
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4360057	27233623	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9206505	23859062	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22660799	55604694	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21498994	50592236	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9206505	23859062	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15537025	28637951	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	8574342	32199534	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9206505	23859062	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4360057	27233623	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat

Markers in Region

D17Got205

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	17	23,144,919 - 23,145,021 (+)	Marker Load Pipeline
mRatBN7.2	17	22,939,104 - 22,939,206 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	22,628,984 - 22,629,085	NCBI	Rnor6.0
Rnor_5.0	17	24,606,609 - 24,606,710	UniSTS	Rnor5.0
RGSC_v3.4	17	28,824,015 - 28,824,116	UniSTS	RGSC3.4
Celera	17	22,612,894 - 22,612,995	UniSTS
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	64	152	91	90	59	50	59	6	311	147	11	123	81	92	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001395610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005495297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY325171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019478 ⟹ ENSRNOP00000019478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	23,136,657 - 23,155,929 (+)	Ensembl
mRatBN7.2 Ensembl	17	22,930,853 - 22,950,114 (+)	Ensembl
Rnor_6.0 Ensembl	17	22,620,721 - 22,639,988 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000060403 ⟹ ENSRNOP00000057148

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	23,135,809 - 23,216,622 (+)	Ensembl
mRatBN7.2 Ensembl	17	22,930,755 - 22,993,826 (+)	Ensembl
Rnor_6.0 Ensembl	17	22,619,891 - 22,688,307 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115307 ⟹ ENSRNOP00000076653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	23,135,809 - 23,199,616 (+)	Ensembl
mRatBN7.2 Ensembl	17	22,930,740 - 22,993,826 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135510 ⟹ ENSRNOP00000102383

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	23,136,570 - 23,201,204 (+)	Ensembl

RefSeq Acc Id:

NM_001014144 ⟹ NP_001014166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	23,113,578 - 23,199,616 (+)	NCBI
mRatBN7.2	17	22,907,758 - 22,993,834 (+)	NCBI
Rnor_6.0	17	22,620,619 - 22,688,296 (+)	NCBI
Rnor_5.0	17	24,597,532 - 24,662,658 (+)	NCBI
RGSC_v3.4	17	28,815,650 - 28,879,571 (+)	RGD
Celera	17	22,604,529 - 22,667,496 (+)	RGD

Sequence:

show sequence

GCAGCTCCGGTGTGAACAGAGTGCAGCTGTGACTCCCAGGACCGAGTGAGAGCAGAGCAGGTAC
ACCGCCACCACCTTCGTCGTCGTCGTCATCGTTCTGATCCACGGAAACCATGACGAAAACAACT
ACTTGCTTGTATCACTTCGTTGTTTTGAACTGGTACATTTTCCTCAATTATTACATCCCACAGA
TTGGAAAGGATGAGGAGAAACTAAAGGAATTCCATGACGGTGGACGGTCCAAGTACTTGACACT
CCTGAATCTGCTCTTGCAGGCCGTTTTCTTTGGGGTCGCCTGCCTGGATGATGTGCTAAAAAGA
GTCATCGGAAGGAAAGACATCAAGTTCATCACCTACTTCAGAGATCTGCTTTTTACTACGCTGG
CTTTTCCTTTATCCACATTTGTATTCTTGGTATTCTGGTCCCTCTTCCACTACGACCGGAGCCT
CGTTTACCCCAAGGGCTTGGATGATTTCTTTCCAGCATGGGTTAATCACGCAATGCATACCTCC
ATATTTCCCTTTTCCCTGGCTGAAACCGTTCTCAGACCACACAACTATCCATCGAAGAAGCTAG
GACTCAGCTTGCTGGGTGCCTGTAATTTTGCCTACATTATCAGGATCCTTTGGCGCTACGTTCA
GACCGGAAACTGGGTGTACCCCGTGTTTGCCTCCCTCAGCCCGCTGGGTATTATTCTCTTCTTC
TCAGCCAGTTACATCCTGAGTGCCAGCCTCTACCTGTTTGGAGAGAAGATCAATCACTGGAAAT
GGGGTGCCACAGTGAAGCCACGGATGAAGAAGAATTGACTACACACTGTTTTCCAAGAAACATG
GAAGAAGAAACTTAAGAACTGGTCCAATTTCTATTATTCTCCTTCTTCTTATTTCTTTTTGGAC
CAGGGTGGAATTGCTTGGGGAGATAAAAAGGATGGAGAATGTTGCATAGTTTTAATAAAGAGCA
TGAAGGGAGCTTGGCTTGGGATCTCCTGGTTTTCTAAAAGACTGACCAATAATTCTTCACATGT
CAGAATCTGTTATGTTTGTCTGACCTCCATGGGAGATTTTGTTTCTGGCTAAAATAAAGGCTAA
ATAAGCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001395610 ⟹ NP_001382539

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	23,135,809 - 23,199,616 (+)	NCBI
mRatBN7.2	17	22,929,994 - 22,993,834 (+)	NCBI

RefSeq Acc Id:

XR_005495297

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	23,135,823 - 23,185,362 (+)	NCBI
mRatBN7.2	17	22,930,012 - 22,979,569 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014166	(Get FASTA)	NCBI Sequence Viewer
	NP_001382539	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88287	(Get FASTA)	NCBI Sequence Viewer
	AAP92572	(Get FASTA)	NCBI Sequence Viewer
	EDL98209	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019478.4
	ENSRNOP00000076653
	ENSRNOP00000076653.1
	ENSRNOP00000102383
GenBank Protein	Q5M828	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014166 ⟸ NM_001014144

- UniProtKB:

Q7TP74 (UniProtKB/Swiss-Prot), Q5M828 (UniProtKB/Swiss-Prot), A0A0H2UI01 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTKTTTCLYHFVVLNWYIFLNYYIPQIGKDEEKLKEFHDGGRSKYLTLLNLLLQAVFFGVACLD
DVLKRVIGRKDIKFITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDDFFPAWVNH
AMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYVQTGNWVYPVFASLSPLG
IILFFSASYILSASLYLFGEKINHWKWGATVKPRMKKN

hide sequence

Ensembl Acc Id:

ENSRNOP00000057148 ⟸ ENSRNOT00000060403

Ensembl Acc Id:

ENSRNOP00000019478 ⟸ ENSRNOT00000019478

Ensembl Acc Id:

ENSRNOP00000076653 ⟸ ENSRNOT00000115307

RefSeq Acc Id:	NP_001382539 ⟸ NM_001395610
- UniProtKB:	Q5M828 (UniProtKB/Swiss-Prot), Q7TP74 (UniProtKB/Swiss-Prot), A0A0H2UI01 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000102383 ⟸ ENSRNOT00000135510

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M828-F1-model_v2	AlphaFold	Q5M828	1-230	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700381

Promoter ID:

EPDNEW_R10904

Type:

initiation region

Name:

Adtrp_2

Description:

androgen-dependent TFPI-regulating protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10905

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	22,619,899 - 22,619,959	EPDNEW

RGD ID:

13700392

Promoter ID:

EPDNEW_R10905

Type:

initiation region

Name:

Adtrp_1

Description:

androgen-dependent TFPI-regulating protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10904

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	22,620,641 - 22,620,701	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305679	AgrOrtholog
BioCyc Gene	G2FUF-9767	BioCyc
Ensembl Genes	ENSRNOG00000014481	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019478.7	UniProtKB/Swiss-Prot
	ENSRNOT00000115307	ENTREZGENE
	ENSRNOT00000115307.1	UniProtKB/Swiss-Prot
	ENSRNOT00000135510	ENTREZGENE
IMAGE_CLONE	IMAGE:7321485	IMAGE-MGC_LOAD
InterPro	Far-17a_AIG1	UniProtKB/Swiss-Prot
KEGG Report	rno:361228	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109474	IMAGE-MGC_LOAD
NCBI Gene	361228	ENTREZGENE
PANTHER	ANDROGEN-DEPENDENT TFPI-REGULATING PROTEIN	UniProtKB/Swiss-Prot
	PTHR10989	UniProtKB/Swiss-Prot
Pfam	Far-17a_AIG1	UniProtKB/Swiss-Prot
PhenoGen	Adtrp	PhenoGen
RatGTEx	ENSRNOG00000014481	RatGTEx
UniProt	A0A0H2UI01	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LCQ3_RAT	UniProtKB/TrEMBL
	ADTRP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q7TP74	ENTREZGENE
UniProt Secondary	Q7TP74	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Adtrp	androgen-dependent TFPI-regulating protein	RGD1305679	similar to 9530008L14Rik protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305679	similar to 9530008L14Rik protein	RGD1305679_predicted	similar to 9530008L14Rik protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305679_predicted	similar to 9530008L14Rik protein (predicted)	LOC361228_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361228_predicted	similar to 9530008L14Rik protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD