Gtf2h3 (general transcription factor IIH subunit 3)

Advanced Search (OLGA)

Gene: Gtf2h3 (general transcription factor IIH subunit 3) Rattus norvegicus

Analyze

Symbol:

Gtf2h3

Name:

general transcription factor IIH subunit 3

RGD ID:

1305494

Description:

Predicted to enable RNA polymerase II general transcription initiation factor activity. Predicted to be involved in nucleotide-excision repair and transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of core TFIIH complex portion of holo TFIIH complex; transcription factor TFIID complex; and transcription preinitiation complex. Orthologous to human GTF2H3 (general transcription factor IIH subunit 3); PARTICIPATES IN RNA polymerase II transcription initiation pathway; nucleotide excision repair pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

general transcription factor IIH, polypeptide 3; LOC288651

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,669,995 - 37,687,505 (-)	NCBI		GRCr8
mRatBN7.2	12	32,009,010 - 32,025,484 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,009,014 - 32,025,497 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,187,754 - 33,203,819 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,799,075 - 33,815,140 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,850,942 - 32,867,007 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,427,556 - 37,444,027 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,427,546 - 37,444,282 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,298,569 - 39,315,037 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,121,881 - 33,138,233 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	32,985,270 - 33,001,621 (-)	NCBI
Celera	12	33,698,431 - 33,714,902 (-)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Joubert syndrome 1 (ISO)

short chain acyl-CoA dehydrogenase deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

epoxiconazole (ISO)

fenthion (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (ISO)

imiquimod (ISO)

inulin (ISO)

ivermectin (ISO)

ketamine (EXP)

methidathion (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

Soman (EXP)

testosterone (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

nucleotide-excision repair (IBA,IEA)

regulation of DNA-templated transcription (IEA)

transcription by RNA polymerase II (IEA,ISO,ISS)

Cellular Component

core TFIIH complex portion of holo TFIIH complex (IEA,ISO,ISS)

nucleoplasm (ISO)

nucleus (ISO,ISS)

transcription factor TFIID complex (IEA,ISO)

transcription factor TFIIH core complex (IBA,IEA)

transcription factor TFIIH holo complex (IBA,IEA,ISO,ISS)

transcription preinitiation complex (IEA,ISO)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II general transcription initiation factor activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

nucleotide excision repair pathway (IEA)

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor.	Egly JM and Coin F, DNA Repair (Amst). 2011 Jul 15;10(7):714-21. doi: 10.1016/j.dnarep.2011.04.021. Epub 2011 May 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:8652557	PMID:9852112	PMID:12477932	PMID:27193682

Genomics

Comparative Map Data

Gtf2h3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	37,669,995 - 37,687,505 (-)	NCBI		GRCr8
mRatBN7.2	12	32,009,010 - 32,025,484 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,009,014 - 32,025,497 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,187,754 - 33,203,819 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	33,799,075 - 33,815,140 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	32,850,942 - 32,867,007 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	37,427,556 - 37,444,027 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	37,427,546 - 37,444,282 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	39,298,569 - 39,315,037 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,121,881 - 33,138,233 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	32,985,270 - 33,001,621 (-)	NCBI
Celera	12	33,698,431 - 33,714,902 (-)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

GTF2H3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	123,633,829 - 123,662,604 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	123,633,739 - 123,662,604 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	124,118,376 - 124,147,151 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	122,684,334 - 122,711,287 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	122,643,260 - 122,670,214	NCBI
Celera	12	123,714,817 - 123,741,772 (+)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	121,079,532 - 121,108,395 (+)	NCBI		HuRef
CHM1_1	12	123,939,235 - 123,968,101 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	123,632,693 - 123,661,470 (+)	NCBI		T2T-CHM13v2.0

Gtf2h3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	124,717,211 - 124,735,743 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	124,717,203 - 124,735,743 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	124,579,148 - 124,597,680 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	124,579,140 - 124,597,680 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	125,029,157 - 125,047,689 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	124,839,789 - 124,857,459 (+)	NCBI		MGSCv36	mm8
Celera	5	121,655,848 - 121,674,546 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	63.67	NCBI

Gtf2h3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	5,365,142 - 5,380,047 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	5,365,669 - 5,380,047 (-)	NCBI	ChiLan1.0	ChiLan1.0

GTF2H3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	131,708,349 - 131,737,682 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	131,704,710 - 131,734,059 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	121,218,813 - 121,246,807 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	125,445,381 - 125,473,763 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	125,445,381 - 125,473,763 (+)	Ensembl	panpan1.1		panPan2

GTF2H3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	5,985,094 - 6,011,253 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	5,985,798 - 6,011,163 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,147,525 - 6,174,121 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,234,737 - 6,261,341 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,234,495 - 6,261,295 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,168,228 - 6,194,816 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	6,260,228 - 6,287,181 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,213,786 - 6,240,388 (-)	NCBI		UU_Cfam_GSD_1.0

Gtf2h3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	158,283,347 - 158,304,710 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	1,173,064 - 1,196,063 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	1,176,154 - 1,196,028 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTF2H3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	29,335,582 - 29,355,435 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	29,335,715 - 29,355,465 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,029,684 - 31,047,752 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTF2H3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	118,961,907 - 118,989,906 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	118,967,974 - 118,989,391 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	126,285,426 - 126,313,975 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtf2h3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	23,422,319 - 23,435,926 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	23,422,289 - 23,437,193 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gtf2h3
172 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	133
Count of miRNA genes:	98
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000001368
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH134486

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,009,242 - 32,009,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	37,427,789 - 37,427,985	NCBI	Rnor6.0
Rnor_5.0	12	39,298,802 - 39,298,998	UniSTS	Rnor5.0
RGSC_v3.4	12	33,122,114 - 33,122,310	UniSTS	RGSC3.4
Celera	12	33,698,664 - 33,698,860	UniSTS
RH 3.4 Map	12	556.8	UniSTS
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC093380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001368 ⟹ ENSRNOP00000001368

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,009,014 - 32,025,497 (-)	Ensembl
Rnor_6.0 Ensembl	12	37,427,546 - 37,444,282 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097451 ⟹ ENSRNOP00000097521

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,009,014 - 32,022,385 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112340 ⟹ ENSRNOP00000090533

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,009,014 - 32,022,319 (-)	Ensembl

RefSeq Acc Id:

NM_001024236 ⟹ NP_001019407

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,669,995 - 37,686,466 (-)	NCBI
mRatBN7.2	12	32,009,010 - 32,025,484 (-)	NCBI
Rnor_6.0	12	37,427,556 - 37,444,027 (-)	NCBI
Rnor_5.0	12	39,298,569 - 39,315,037 (-)	NCBI
RGSC_v3.4	12	33,121,881 - 33,138,233 (-)	RGD
Celera	12	33,698,431 - 33,714,902 (-)	RGD

Sequence:

show sequence

CTCTTCACCGAGGCATAGGGAGCCATGGCCGCGGACGAAGATGAGTTGAATCTTCTGGTTATCA
TAGTTGACACCAACCCGATTTGGTGGGGAAAGCAAGCGTTAAAGGAATCTCAGTTCACTCTGTC
CAAGTGCATGGATGCTGTGATGGTGCTGGCAAACGCCCACCTGTTCATGAACCGCTCCAACCAG
CTAGCGGTCATCGCCAGCCACATTCAGGAAAGTCGATTCTTATACCCGGGGAAGAACGGCCGAC
TCGGAGACTTCTTCGGAGATCCTGGCAACGCCCTTCCTGACTGTAATCCCTCTGGGAGTAAGGA
CGGGAAATATGAGCTGTTGACAGCGGCAAACGAGGTGATCGCCGAGGAGATCAAGGATCTGATG
ACCAAGAGTGACATCAAGGGCCAGCACACGGAGACCCTACTGGCAGGATCCCTCGCCAAGGCCC
TCTGCTACATTCACAGAGCGAGCAAGGCAGTGAAAGATAATCAGGAGATGAAATCAAGGATTTT
GGTCATCAAGGCTGCAGAGGACAGTGCACTGCAGTACATGAACTTCATGAACGTCATCTTTGCT
GCTCAGAAGCAGAATATCCTCATCGATGCCTGCGTCCTGGACTCGGATTCAGGGCTCCTCCAGC
AGGCTTGTGACATCACTGGGGGACTGTACCTGAAGGTGCCTCAGATGCCTTCTCTCCTGCAGTA
CTTACTGTGGGTTTTTCTTCCGGATCAAGACCAGCGATCTCAGCTAATCCTCCCACCTCCGATC
CACGTGGACTATAGGGCTGCCTGCTTCTGCCATCGAAGTCTCATTGAGATTGGCTATGTCTGCT
CTGTGTGTCTGTCTATTTTCTGCAACTTCAGCCCCATCTGCACCACGTGCGAGACAGCTTTTAA
GATCTCCCTCCCTCCTGTGCTGAAGGCCAAGAAAAAGAAACAGAAGGTGTCCCTGTGATGAGTG
ATACAAACTTCCCCATCTCTTCCCACCGGCTGCCTCTCTGTAGGGAGCACGGAAGACTTTGAAG
CACCGCCTTTGTTCTGTACTTTTAGGGTGTGAGGCTGGAGAGTACGCACCCCTCTGATTCATCT
GGAAGGGGGACGGCTTTGTAGGTTGTTGTGGGGTAGCAGGTGCCTGTCGGATGCTAATCTGTGG
CTGTTTTGTTAGTTGTTGCTTGGATGCTTGGTGCTGGGGTTTGAACCCTAGCCTTGCACGAGCT
AGCCCTACAGCCCACCTCAGAACTGCAGTGGGCCCCTGGGATTTTGTTTTCACATGATCCTCTG
TCAAAGCTTATGTGGTGGGTGCTGGGTCTTCTGTACTTCAGAAGTGTGTGAGGTTGGGACGTCG
TCTGGGAGGGTGACCGGCACCGGGTCACTGTGGGCCGTGACAGAATATCTTAGTTGCTCAGGTG
ATGCACGCCTGGAACCTTGAACTTAGGAGGCTGAGACAGGAAGGTTTGGGGTTCGGATCCTGCT
TGGGATATGTATGAAGTGCCGGCTTTTTTTCTTTCTTTCTTTTTTTCTTTTTTTAACAGAAGAA
CATTTTACTTCAAATAAATTGTTTCCTTCAACTGTTTTCAAATATAACCAGACATAAAGGCACA
GCCTTCCATCTCAGCACTCAGGGAGCCCAGACAAGTGCATCACTGCGTTTGAGGCCAGCCAGGT
CTACATAGTGAGTTCAGACCACACCAACCAGGGTTGCATCTTGCCACCTTGTTTACAAAAAATA
AAACCCCAAACCAGTCACGTTCACAGGGAGAACCGCTGACCATTAGAAATGTAAATGAGTTCAG
GAGAAACGTTTGTACTCTCAACAATAAAGTCCTATTTTTGTATTTACTAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271173 ⟹ XP_063127243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	37,669,995 - 37,687,505 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019407	(Get FASTA)	NCBI Sequence Viewer
	XP_063127243	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93380	(Get FASTA)	NCBI Sequence Viewer
	EDM13571	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001368.4
	ENSRNOP00000090533.1
	ENSRNOP00000097521.1
GenBank Protein	Q561R7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019407 ⟸ NM_001024236

- UniProtKB:

Q561R7 (UniProtKB/Swiss-Prot), A6J0Y2 (UniProtKB/TrEMBL), A0A8I6ASU2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANAHLFMNRSNQLAVIASHI
QESRFLYPGKNGRLGDFFGDPGNALPDCNPSGSKDGKYELLTAANEVIAEEIKDLMTKSDIKGQ
HTETLLAGSLAKALCYIHRASKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILI
DACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAAC
FCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQKVSL

hide sequence

Ensembl Acc Id:

ENSRNOP00000001368 ⟸ ENSRNOT00000001368

Ensembl Acc Id:

ENSRNOP00000097521 ⟸ ENSRNOT00000097451

Ensembl Acc Id:

ENSRNOP00000090533 ⟸ ENSRNOT00000112340

RefSeq Acc Id:	XP_063127243 ⟸ XM_063271173
- Peptide Label:	isoform X1
- UniProtKB:	Q561R7 (UniProtKB/Swiss-Prot), A6J0Y2 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q561R7-F1-model_v2	AlphaFold	Q561R7	1-309	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698607

Promoter ID:

EPDNEW_R9131

Type:

multiple initiation site

Name:

Gtf2h3_1

Description:

general transcription factor IIH subunit 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	37,444,047 - 37,444,107	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305494	AgrOrtholog
BioCyc Gene	G2FUF-19361	BioCyc
Ensembl Genes	ENSRNOG00000001035	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001368.7	UniProtKB/Swiss-Prot
	ENSRNOT00000097451.1	UniProtKB/TrEMBL
	ENSRNOT00000112340.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.410	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7388486	IMAGE-MGC_LOAD
InterPro	TFIIH_Tfb4/GTF2H3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	vWFA_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:288651	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:112674	IMAGE-MGC_LOAD
NCBI Gene	288651	ENTREZGENE
PANTHER	GENERAL TRANSCRIPTION FACTOR IIH SUBUNIT 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12831	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Tfb4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gtf2h3	PhenoGen
RatGTEx	ENSRNOG00000001035	RatGTEx
UniProt	A0A8I6AA93_RAT	UniProtKB/TrEMBL
	A0A8I6ASU2	ENTREZGENE, UniProtKB/TrEMBL
	A6J0Y2	ENTREZGENE, UniProtKB/TrEMBL
	Q561R7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-25	Gtf2h3	general transcription factor IIH subunit 3	Gtf2h3	general transcription factor IIH, polypeptide 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gtf2h3	general transcription factor IIH, polypeptide 3	Gtf2h3_predicted	general transcription factor IIH, polypeptide 3 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gtf2h3_predicted	general transcription factor IIH, polypeptide 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)