Advanced Search (OLGA)

Gene: Rpp25 (ribonuclease P/MRP subunit p25) Rattus norvegicus

Analyze

Symbol:

Rpp25

Name:

ribonuclease P/MRP subunit p25 (Ensembl:ribonuclease P and MRP subunit p25)

RGD ID:

1305290

Description:

Predicted to enable ribonuclease P RNA binding activity. Predicted to contribute to ribonuclease P activity. Predicted to be involved in tRNA 5'-leader removal. Predicted to be located in centriolar satellite; nucleolus; and nucleoplasm. Predicted to be part of multimeric ribonuclease P complex and ribonuclease MRP complex. Orthologous to human RPP25 (ribonuclease P and MRP subunit p25); PARTICIPATES IN tRNA maturation pathway; ribosome biogenesis pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315705; ribonuclease P 25 subunit; ribonuclease P 25 subunit (human); ribonuclease P and MRP subunit p25; ribonuclease P protein subunit p25; ribonuclease P/MRP 25 subunit; RNase P protein subunit p25

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPP25 (ribonuclease P/MRP subunit p25)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpp25 (ribonuclease P/MRP 25 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpp25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPP25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPP25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPP25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPP25 (ribonuclease P/MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpp25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rpp25 (ribonuclease P and MRP subunit p25)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPP25 (ribonuclease P/MRP subunit p25)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpp25 (ribonuclease P/MRP 25 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK632.14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	ZK632.14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG9422	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG9422	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	rpp25a	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rpp25a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rpp25b	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpp25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpp25	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	66,803,262 - 66,804,642 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	66,803,212 - 66,810,550 (+)	Ensembl				GRCr8
mRatBN7.2	8	57,907,352 - 57,908,732 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	57,907,352 - 57,908,732 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	63,438,964 - 63,440,342 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	61,717,711 - 61,719,089 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	59,582,249 - 59,583,627 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	62,283,336 - 62,284,716 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,283,336 - 62,284,716 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	62,060,880 - 62,062,260 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	61,248,740 - 61,250,120 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	57,373,535 - 57,374,915 (+)	NCBI		Celera
RGSC_v3.1	8	61,267,793 - 61,269,173 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

Cuprizon (EXP)

cytarabine (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

flutamide (EXP)

furan (EXP)

genistein (ISO)

iron dichloride (ISO)

itraconazole (ISO)

ketoconazole (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

okadaic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

T-2 toxin (ISO)

tebuconazole (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

rRNA processing (IEA)

tRNA 5'-leader removal (IBA,IEA,ISO,ISS)

tRNA processing (IEA)

Cellular Component

multimeric ribonuclease P complex (IEA,ISO,ISS)

nucleolus (IEA)

nucleoplasm (IEA,ISO)

ribonuclease MRP complex (IBA,IEA,ISO)

Molecular Function

nucleic acid binding (IEA)

protein binding (ISO)

ribonuclease P activity (IEA,ISO,ISS)

ribonuclease P RNA binding (IEA,ISO,ISS)

RNA binding (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

RNA transport pathway (IEA)

tRNA maturation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	RPP25 is developmentally regulated in prefrontal cortex and expressed at decreased levels in autism spectrum disorder.	Huang HS, etal., Autism Res. 2010 Aug;3(4):153-61. doi: 10.1002/aur.141.
4.	Unexpected diversity of RNase P, an ancient tRNA processing enzyme: challenges and prospects.	Lai LB, etal., FEBS Lett. 2010 Jan 21;584(2):287-96. doi: 10.1016/j.febslet.2009.11.048. Epub .
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:16723659	PMID:22658674	PMID:30454648

Genomics

Comparative Map Data

Rpp25
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	66,803,262 - 66,804,642 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	66,803,212 - 66,810,550 (+)	Ensembl				GRCr8
mRatBN7.2	8	57,907,352 - 57,908,732 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	57,907,352 - 57,908,732 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	63,438,964 - 63,440,342 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	61,717,711 - 61,719,089 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	59,582,249 - 59,583,627 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	62,283,336 - 62,284,716 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	62,283,336 - 62,284,716 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	62,060,880 - 62,062,260 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	61,248,740 - 61,250,120 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	57,373,535 - 57,374,915 (+)	NCBI		Celera
RGSC_v3.1	8	61,267,793 - 61,269,173 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

RPP25
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	74,954,418 - 74,956,772 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	74,954,418 - 74,956,772 (-)	Ensembl			hg38	GRCh38
GRCh37	15	75,246,759 - 75,249,113 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	73,034,496 - 73,036,828 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	73,034,703 - 73,036,828	NCBI
Celera	15	52,197,836 - 52,200,168 (-)	NCBI		Celera
Cytogenetic Map	15	q24.2	NCBI
HuRef	15	52,044,189 - 52,046,521 (-)	NCBI		HuRef
CHM1_1	15	75,366,010 - 75,368,342 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	72,824,301 - 72,826,655 (-)	NCBI		T2T-CHM13v2.0

Rpp25
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	57,411,385 - 57,412,730 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	57,411,309 - 57,412,731 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	57,504,102 - 57,505,447 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	57,504,026 - 57,505,448 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	57,351,909 - 57,353,254 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	57,302,239 - 57,303,584 (+)	NCBI		MGSCv36	mm8
Celera	9	54,739,705 - 54,741,050 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	31.05	NCBI

Rpp25
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	3,026,502 - 3,027,065 (+)	Ensembl
ChiLan1.0	NW_004955450	3,026,257 - 3,027,683 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPP25
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	64,180,780 - 64,185,656 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	68,345,367 - 68,346,753 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	53,895,547 - 53,897,922 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1 Ensembl	15	73,513,375 - 73,513,974 (-)	Ensembl			panPan2	panpan1.1

RPP25
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	37,987,516 - 37,988,991 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	37,988,169 - 37,988,768 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	37,918,780 - 37,920,138 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	38,191,890 - 38,193,248 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	38,192,544 - 38,193,143 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	38,144,796 - 38,146,153 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	38,190,924 - 38,192,276 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	38,426,532 - 38,427,892 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

RPP25
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	58,608,543 - 58,610,078 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	58,605,850 - 58,610,086 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	63,297,508 - 63,299,032 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPP25
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	8,516,782 - 8,520,101 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	8,517,948 - 8,518,547 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666048	133,146,522 - 133,149,822 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpp25
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624894	134,804 - 135,364 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624894	134,202 - 136,226 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rpp25
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	51,393,365 - 51,394,855 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rpp25
5 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	228
Count of miRNA genes:	150
Interacting mature miRNAs:	160
Transcripts:	ENSRNOT00000025410
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	49610204	68373388	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	50763951	67219641	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat

Markers in Region

Rpp25

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	57,907,640 - 57,908,489 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	62,283,625 - 62,284,473	NCBI	Rnor6.0
Rnor_5.0	8	62,061,169 - 62,062,017	UniSTS	Rnor5.0
RGSC_v3.4	8	61,249,029 - 61,249,877	UniSTS	RGSC3.4
Celera	8	57,373,824 - 57,374,672	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	9	67	153	91	90	59	82	59	6	341	177	10	133	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025410 ⟹ ENSRNOP00000025408

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	66,803,212 - 66,810,550 (+)	Ensembl
mRatBN7.2 Ensembl	8	57,907,352 - 57,908,732 (+)	Ensembl
Rnor_6.0 Ensembl	8	62,283,336 - 62,284,716 (+)	Ensembl

RefSeq Acc Id:

NM_001012124 ⟹ NP_001012124

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	66,803,262 - 66,804,642 (+)	NCBI
mRatBN7.2	8	57,907,352 - 57,908,732 (+)	NCBI
Rnor_6.0	8	62,283,336 - 62,284,716 (+)	NCBI
Rnor_5.0	8	62,060,880 - 62,062,260 (+)	NCBI
RGSC_v3.4	8	61,248,740 - 61,250,120 (+)	RGD
Celera	8	57,373,535 - 57,374,915 (+)	RGD

Sequence:

show sequence

GTAGAACAGCACTACCCTGTAGAAGTCTGGGCTGAAGACTCCGCGTTCCCTGCTCACCCTCCAG
CTTTCACTCGGTGCCAGCATCCCAATTCCTGCCGGCCCTCGCCCGGCACGACCCGCGGCCATGC
AGCCCCGGGCTTGAGGCGGCCCCATGGCAAAACCTGCGATCCCAGCGACGACGGCGCATGGAGA
ACTTCCGTAAGGTGCGCTCGGAGGAGGCGCCGGCGGGGGACGGTGATGAGGGTGGCAGCCCGAG
CTCTGGCCCTTTTGCAGATCTGGCGCCTGGTGCTGTACACATGCGGGTCAAGGAGGGCAGCAAG
ATCCGCAACCTGCTGGCCTTCGCCACCGCTAGCATGGCGCAGCCAGCCACGCGCGCCATCGTCT
TCAGCGGCTGCGGCCGGGCCACCACCAAGACCGTCACGTGCGCCGAGATTCTCAAGCGCCGCCT
GGCGGGCTTACACCAGGTCACGCGGCTGCGCTACAGGAGCGTGCGCGAGGTGTGGCAGAGCCTC
CCGCCTGGGCCCACACCGGGTCAGACGCCCAGCGATCCGGCCGCCAGTCTCAGTGTACTTAAGA
ATGTACCGAGCCTCGCCATCCTACTTTCAAAGGACGCACTGGATCCACGACAGCTTGGCTACCA
GCCCCCGAACCTCAGTCCTGGTCCTTCGTCCCCTCCTACCGTGTCGACGTCCAAGAGGAGCCTG
GGGGAATCTGCAGCTGGAGAAGGCACAGCTAAGCGGTCTCAGCCTGAGCCAGAGGCTGAGAATG
AGGACCGGACTGCCTGAGAATTCTCGCCTCTGAACCACCTAGACTGGATCTTATATCTTCAACA
CACCTACATCCACATGCACCCTTCCTACCTGGGTTTTAAGGGGCCCATGTTCCTGAATATTGGT
CCTCAAAATGACAACGCGGATCCCAAGGCGACAGGAGAGGGAGCTCAAGAATTACAAGAGAGGA
TTCTTGAAGTCCGAGGAAAACTTTGTGGGACATGTTGCCAGAAGCCACAGAACACCACCCACAC
CTTTTCTAGGCCATCTTTTTTAGGGAAGCCTGGTGGGTAGTGGGACTCTTGAGCTTTCTTGGGG
ACCCAGACGTTAAAAGCACCCAGTGTGCATGGAGGCTGACAGTTGAGGCTTTAAAAACCGTCCT
TGTTGTTAACTGAGAGCAGGAGCTGTGAAGCTGTTTCCTTGAGGGTGACCAAGTTGAAAATGTC
TGGACCCTGTTCTGCCCACCCACACCCTAGCATATTCCTTTTAGCTTCCCCCCACCCTCACCCC
TGTTGCATGGTGGCAGAGACGGGACCCAGGAGGAAACTTGCCATGCTTCCTCCCCTGAGTCCTG
CTGGAGTATTGCTTCCAATAAAACAAACATGAAAATGAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012124	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87592	(Get FASTA)	NCBI Sequence Viewer
	EDL95627	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025408
	ENSRNOP00000025408.2
GenBank Protein	Q5PPN2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012124 ⟸ NM_001012124

- UniProtKB:

Q5PPN2 (UniProtKB/Swiss-Prot), A6J4V4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MENFRKVRSEEAPAGDGDEGGSPSSGPFADLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRA
IVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTPGQTPSDPAASLSV
LKNVPSLAILLSKDALDPRQLGYQPPNLSPGPSSPPTVSTSKRSLGESAAGEGTAKRSQPEPEA
ENEDRTA

hide sequence

Ensembl Acc Id:

ENSRNOP00000025408 ⟸ ENSRNOT00000025410

Protein Domains

DNA/RNA-binding protein Alba-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PPN2-F1-model_v2	AlphaFold	Q5PPN2	1-199	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696011

Promoter ID:

EPDNEW_R6535

Type:

single initiation site

Name:

Rpp25_1

Description:

ribonuclease P and MRP subunit p25

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	62,283,331 - 62,283,391	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305290	AgrOrtholog
BioCyc Gene	G2FUF-30311	BioCyc
Ensembl Genes	ENSRNOG00000018812	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025410	ENTREZGENE
	ENSRNOT00000025410.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.110.20	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7309941	IMAGE-MGC_LOAD
InterPro	Alba-like_dom_sf	UniProtKB/Swiss-Prot
	Alba-like_NAB	UniProtKB/Swiss-Prot
	DNA/RNA-bd_Alba-like	UniProtKB/Swiss-Prot
KEGG Report	rno:315705	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105790	IMAGE-MGC_LOAD
NCBI Gene	315705	ENTREZGENE
PANTHER	PTHR13516:SF5	UniProtKB/Swiss-Prot
	RIBONUCLEASE P SUBUNIT P25	UniProtKB/Swiss-Prot
Pfam	Alba	UniProtKB/Swiss-Prot
PhenoGen	Rpp25	PhenoGen
RatGTEx	ENSRNOG00000018812	RatGTEx
Superfamily-SCOP	SSF82704	UniProtKB/Swiss-Prot
UniProt	A6J4V4	ENTREZGENE, UniProtKB/TrEMBL
	Q5PPN2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Rpp25	ribonuclease P/MRP subunit p25	Rpp25	ribonuclease P and MRP subunit p25	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-03-27	Rpp25	ribonuclease P and MRP subunit p25	Rpp25	ribonuclease P/MRP 25 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-05-03	Rpp25	ribonuclease P/MRP 25 subunit	Rpp25	ribonuclease P 25 subunit (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Rpp25	ribonuclease P 25 subunit (human)	Rpp25_predicted	ribonuclease P 25 subunit (human) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rpp25_predicted	ribonuclease P (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)