Symbol:
Tnks2
Name:
tankyrase 2
RGD ID:
1305026
Description:
Predicted to enable NAD+ poly-ADP-ribosyltransferase activity; NAD+-protein mono-ADP-ribosyltransferase activity; and enzyme binding activity. Predicted to be involved in several processes, including positive regulation of canonical Wnt signaling pathway; post-translational protein modification; and regulation of telomere maintenance. Predicted to act upstream of or within regulation of growth. Predicted to be located in nuclear envelope; pericentriolar material; and perinuclear region of cytoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human TNKS2 (tankyrase 2); PARTICIPATES IN ADP-ribosylation pathway, mono and poly-ribosylation; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC100910717; LOC309512; poly [ADP-ribose] polymerase tankyrase-2; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2; tankyrase-2; tankyrase-2-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 243,980,432 - 244,033,629 (+) NCBI GRCr8 mRatBN7.2 1 234,567,888 - 234,621,079 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 234,567,858 - 234,621,079 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 242,957,470 - 243,010,368 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 249,885,628 - 249,938,508 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 242,723,807 - 242,776,700 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 255,478,794 - 255,532,143 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,479,261 - 255,532,143 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,479,261 - 255,532,143 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 262,953,201 - 263,006,973 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 241,112,141 - 241,164,804 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 241,253,368 - 241,345,984 NCBI Celera 1 231,660,758 - 231,713,638 NCBI Celera Cytogenetic Map 1 q53 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnks2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tnks2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNKS2 mRNA CTD PMID:36331819 Tnks2 Rat 1,2-dimethylhydrazine decreases expression ISO Tnks2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TNKS2 mRNA CTD PMID:22206623 Tnks2 Rat 17beta-estradiol decreases expression ISO Tnks2 (Mus musculus) 6480464 Estradiol results in decreased expression of TNKS2 mRNA CTD PMID:19484750 Tnks2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNKS2 mRNA CTD PMID:21215274 Tnks2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TNKS2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNKS2 mRNA CTD PMID:17101203 Tnks2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TNKS2 mRNA CTD PMID:21346803 Tnks2 Rat 2-hydroxypropanoic acid decreases expression ISO TNKS2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TNKS2 mRNA CTD PMID:30851411 Tnks2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TNKS2 mRNA CTD PMID:28522335 Tnks2 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of TNKS2 mRNA CTD PMID:19162173 Tnks2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Tnks2 (Mus musculus) 6480464 bisphenol S results in decreased expression of TNKS2 mRNA CTD PMID:39298647 Tnks2 Rat aflatoxin B1 decreases methylation ISO TNKS2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TNKS2 gene CTD PMID:27153756 Tnks2 Rat aflatoxin B1 increases expression ISO Tnks2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of TNKS2 mRNA CTD PMID:19770486 Tnks2 Rat arsenite(3-) multiple interactions ISO TNKS2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TNKS2 mRNA] CTD PMID:32406909 Tnks2 Rat arsenous acid increases expression ISO Tnks2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of TNKS2 mRNA CTD PMID:35676786 Tnks2 Rat benzo[a]pyrene increases mutagenesis ISO TNKS2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of TNKS2 gene CTD PMID:25435355 Tnks2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TNKS2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tnks2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Tnks2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TNKS2 mRNA CTD PMID:33754040 and PMID:34319233 Tnks2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TNKS2 mRNA CTD PMID:25181051 Tnks2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNKS2 mRNA CTD PMID:34947998 Tnks2 Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of TNKS2 mRNA CTD PMID:20864626 Tnks2 Rat carbon nanotube increases expression ISO Tnks2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of TNKS2 mRNA CTD PMID:25554681 Tnks2 Rat chromium(6+) multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TNKS2 mRNA CTD PMID:38479592 Tnks2 Rat cisplatin increases expression ISO Tnks2 (Mus musculus) 6480464 Cisplatin results in increased expression of TNKS2 mRNA CTD PMID:21151649 Tnks2 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TNKS2 mRNA CTD PMID:17602206 Tnks2 Rat cyclosporin A increases expression ISO TNKS2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TNKS2 mRNA CTD PMID:20106945 Tnks2 Rat cyproconazole decreases expression ISO Tnks2 (Mus musculus) 6480464 cyproconazole results in decreased expression of TNKS2 mRNA CTD PMID:22334560 Tnks2 Rat diarsenic trioxide increases expression ISO Tnks2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of TNKS2 mRNA CTD PMID:35676786 Tnks2 Rat Dibutyl phosphate affects expression ISO TNKS2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TNKS2 mRNA CTD PMID:37042841 Tnks2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TNKS2 mRNA CTD PMID:21266533 Tnks2 Rat dicrotophos decreases expression ISO TNKS2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of TNKS2 mRNA CTD PMID:28302478 Tnks2 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of TNKS2 mRNA CTD PMID:21551480 Tnks2 Rat dorsomorphin multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNKS2 mRNA CTD PMID:27188386 Tnks2 Rat epoxiconazole decreases expression ISO Tnks2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TNKS2 mRNA CTD PMID:22334560 Tnks2 Rat ethanol affects splicing ISO Tnks2 (Mus musculus) 6480464 Ethanol affects the splicing of TNKS2 mRNA CTD PMID:30319688 Tnks2 Rat ethyl methanesulfonate increases expression ISO TNKS2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of TNKS2 mRNA CTD PMID:23649840 Tnks2 Rat fenthion decreases expression ISO Tnks2 (Mus musculus) 6480464 Fenthion results in decreased expression of TNKS2 mRNA CTD PMID:34813904 Tnks2 Rat geldanamycin increases expression ISO TNKS2 (Homo sapiens) 6480464 geldanamycin results in increased expression of TNKS2 mRNA CTD PMID:26705709 Tnks2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TNKS2 mRNA CTD PMID:22061828 Tnks2 Rat methidathion decreases expression ISO Tnks2 (Mus musculus) 6480464 methidathion results in decreased expression of TNKS2 mRNA CTD PMID:34813904 Tnks2 Rat methoxyacetic acid increases expression EXP 6480464 methoxyacetic acid results in increased expression of TNKS2 mRNA CTD PMID:20864626 Tnks2 Rat methyl methanesulfonate increases expression ISO TNKS2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TNKS2 mRNA CTD PMID:23649840 Tnks2 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of TNKS2 mRNA CTD PMID:20864626 Tnks2 Rat methylmercury chloride multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNKS2 mRNA CTD PMID:27188386 Tnks2 Rat methylmercury chloride increases expression ISO TNKS2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TNKS2 mRNA CTD PMID:26272509 Tnks2 Rat Monobutylphthalate increases expression EXP 6480464 monobutyl phthalate results in increased expression of TNKS2 mRNA CTD PMID:20864626 Tnks2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of TNKS2 mRNA CTD PMID:17602206 Tnks2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of TNKS2 mRNA CTD PMID:26720608 Tnks2 Rat paracetamol affects expression ISO Tnks2 (Mus musculus) 6480464 Acetaminophen affects the expression of TNKS2 mRNA CTD PMID:17562736 Tnks2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tnks2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNKS2 mRNA CTD PMID:36331819 Tnks2 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of TNKS2 mRNA CTD PMID:19162173 Tnks2 Rat phenobarbital affects expression ISO Tnks2 (Mus musculus) 6480464 Phenobarbital affects the expression of TNKS2 mRNA CTD PMID:23091169 Tnks2 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of TNKS2 mRNA CTD PMID:26923065 Tnks2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of TNKS2 mRNA CTD PMID:19162173 Tnks2 Rat propiconazole decreases expression ISO Tnks2 (Mus musculus) 6480464 propiconazole results in decreased expression of TNKS2 mRNA CTD PMID:21278054 and PMID:22334560 Tnks2 Rat rac-lactic acid decreases expression ISO TNKS2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TNKS2 mRNA CTD PMID:30851411 Tnks2 Rat resveratrol multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TNKS2 mRNA CTD PMID:23557933 Tnks2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TNKS2 mRNA CTD PMID:28374803 Tnks2 Rat rucaparib affects binding ISO TNKS2 (Homo sapiens) 6480464 rucaparib binds to TNKS2 protein CTD PMID:28001384 Tnks2 Rat SB 431542 multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNKS2 mRNA CTD PMID:27188386 Tnks2 Rat sodium arsenite decreases expression ISO TNKS2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TNKS2 mRNA CTD PMID:28595984 Tnks2 Rat sodium arsenite increases expression ISO TNKS2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TNKS2 mRNA CTD PMID:38568856 Tnks2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of TNKS2 mRNA CTD PMID:19281266 Tnks2 Rat succimer multiple interactions ISO TNKS2 (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of TNKS2 mRNA CTD PMID:26378955 Tnks2 Rat sunitinib increases expression ISO TNKS2 (Homo sapiens) 6480464 Sunitinib results in increased expression of TNKS2 mRNA CTD PMID:31533062 Tnks2 Rat titanium dioxide decreases methylation ISO Tnks2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TNKS2 gene CTD PMID:35295148 Tnks2 Rat triphenyl phosphate affects expression ISO TNKS2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TNKS2 mRNA CTD PMID:37042841 Tnks2 Rat troglitazone decreases expression ISO Tnks2 (Mus musculus) 6480464 troglitazone results in decreased expression of TNKS2 mRNA CTD PMID:28973697 Tnks2 Rat valproic acid decreases methylation ISO TNKS2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TNKS2 gene CTD PMID:29154799 Tnks2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TNKS2 mRNA CTD PMID:20566332 Tnks2 Rat XAV939 multiple interactions ISO TNKS2 (Homo sapiens) 6480464 XAV939 binds to and results in decreased activity of TNKS2 protein CTD PMID:28001384
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) caffeine (EXP) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibric acid (EXP) cyclosporin A (ISO) cyproconazole (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diuron (EXP) dorsomorphin (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) geldanamycin (ISO) gentamycin (EXP) methidathion (ISO) methoxyacetic acid (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP,ISO) Monobutylphthalate (EXP) N-nitrosodiethylamine (EXP) nitrofen (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) poly(I:C) (EXP) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) rucaparib (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sunitinib (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) XAV939 (ISO)
Biological Process
biological_process (ND) multicellular organism growth (ISO) negative regulation of telomere maintenance via telomere lengthening (IEA,ISO) positive regulation of canonical Wnt signaling pathway (IBA,IEA,ISO) positive regulation of telomere capping (IBA,IEA,ISO) protein auto-ADP-ribosylation (IEA,ISO) protein localization to chromosome, telomeric region (IBA,IEA,ISO) protein poly-ADP-ribosylation (IEA,ISO) protein polyubiquitination (IEA,ISO) regulation of multicellular organism growth (ISO) telomere maintenance (ISO)
Tnks2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 243,980,432 - 244,033,629 (+) NCBI GRCr8 mRatBN7.2 1 234,567,888 - 234,621,079 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 234,567,858 - 234,621,079 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 242,957,470 - 243,010,368 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 249,885,628 - 249,938,508 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 242,723,807 - 242,776,700 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 255,478,794 - 255,532,143 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,479,261 - 255,532,143 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 255,479,261 - 255,532,143 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 262,953,201 - 263,006,973 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 241,112,141 - 241,164,804 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 241,253,368 - 241,345,984 NCBI Celera 1 231,660,758 - 231,713,638 NCBI Celera Cytogenetic Map 1 q53 NCBI
TNKS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 91,798,426 - 91,865,475 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 91,798,426 - 91,865,475 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 93,558,183 - 93,625,232 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 93,548,049 - 93,615,012 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 93,548,048 - 93,615,012 NCBI Celera 10 87,301,773 - 87,368,904 (+) NCBI Celera Cytogenetic Map 10 q23.32 NCBI HuRef 10 87,186,894 - 87,254,191 (+) NCBI HuRef CHM1_1 10 93,839,907 - 93,906,988 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 92,681,611 - 92,748,788 (+) NCBI T2T-CHM13v2.0
Tnks2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 36,811,583 - 36,870,877 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 36,811,632 - 36,870,877 (+) Ensembl GRCm39 Ensembl GRCm38 19 36,834,129 - 36,893,477 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 36,834,232 - 36,893,477 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 36,908,722 - 36,967,967 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 36,832,583 - 36,958,617 (+) NCBI MGSCv36 mm8 Celera 19 37,609,652 - 37,668,932 (+) NCBI Celera Cytogenetic Map 19 C2 NCBI cM Map 19 31.96 NCBI
Tnks2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 1,417,679 - 1,492,267 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 1,419,013 - 1,492,267 (-) NCBI ChiLan1.0 ChiLan1.0
TNKS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 103,837,790 - 103,903,675 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 103,843,094 - 103,908,990 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 88,547,396 - 88,612,973 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 92,070,362 - 92,134,911 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 92,070,362 - 92,134,911 (+) Ensembl panpan1.1 panPan2
TNKS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 6,286,125 - 6,354,284 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 6,285,690 - 6,352,317 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 6,462,048 - 6,530,287 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 6,540,024 - 6,608,295 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 6,539,063 - 6,608,204 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 6,266,668 - 6,334,898 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 6,299,503 - 6,367,799 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 6,463,794 - 6,532,479 (+) NCBI UU_Cfam_GSD_1.0
Tnks2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 41,142,964 - 41,205,100 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936601 2,776,345 - 2,837,707 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936601 2,776,338 - 2,837,703 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TNKS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 103,396,459 - 103,461,821 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 103,396,424 - 103,461,830 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 112,909,835 - 112,975,236 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TNKS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 85,074,228 - 85,140,761 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 85,074,667 - 85,143,054 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 45,805,170 - 45,871,377 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnks2
.
Predicted Target Of
Count of predictions: 646 Count of miRNA genes: 296 Interacting mature miRNAs: 386 Transcripts: ENSRNOT00000039942, ENSRNOT00000075210 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
RH130135
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,620,261 - 234,620,471 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,531,326 - 255,531,535 NCBI Rnor6.0 Rnor_5.0 1 263,006,156 - 263,006,365 UniSTS Rnor5.0 Rnor_5.0 1 262,829,184 - 262,829,393 UniSTS Rnor5.0 RGSC_v3.4 1 241,163,987 - 241,164,196 UniSTS RGSC3.4 Celera 1 231,712,821 - 231,713,030 UniSTS RH 3.4 Map 1 1583.2 UniSTS Cytogenetic Map 1 q53 UniSTS
BF386861
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,618,677 - 234,618,837 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,529,742 - 255,529,901 NCBI Rnor6.0 Rnor_5.0 1 263,004,572 - 263,004,731 UniSTS Rnor5.0 Rnor_5.0 1 262,827,600 - 262,827,759 UniSTS Rnor5.0 RGSC_v3.4 1 241,162,403 - 241,162,562 UniSTS RGSC3.4 Celera 1 231,711,237 - 231,711,396 UniSTS RH 3.4 Map 1 1584.4 UniSTS Cytogenetic Map 1 q53 UniSTS
BF394203
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,588,842 - 234,589,006 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,499,911 - 255,500,074 NCBI Rnor6.0 Rnor_5.0 1 262,974,127 - 262,974,290 UniSTS Rnor5.0 Rnor_5.0 1 262,797,770 - 262,797,933 UniSTS Rnor5.0 RGSC_v3.4 1 241,132,571 - 241,132,734 UniSTS RGSC3.4 Celera 1 231,681,408 - 231,681,571 UniSTS RH 3.4 Map 1 1583.0 UniSTS Cytogenetic Map 1 q53 UniSTS
AI599623
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 234,608,259 - 234,608,400 (+) MAPPER mRatBN7.2 Rnor_6.0 1 255,519,325 - 255,519,465 NCBI Rnor6.0 Rnor_5.0 1 262,993,998 - 262,994,138 UniSTS Rnor5.0 Rnor_5.0 1 262,817,184 - 262,817,324 UniSTS Rnor5.0 RGSC_v3.4 1 241,151,985 - 241,152,125 UniSTS RGSC3.4 Celera 1 231,700,822 - 231,700,962 UniSTS RH 3.4 Map 1 1582.8 UniSTS Cytogenetic Map 1 q53 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
15
12
55
145
125
121
77
32
77
12
278
123
113
55
79
44
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000079808 ⟹ ENSRNOP00000068637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 234,567,858 - 234,621,079 (+) Ensembl Rnor_6.0 Ensembl 1 255,479,261 - 255,532,143 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085497 ⟹ ENSRNOP00000073499
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 234,567,858 - 234,621,079 (+) Ensembl
RefSeq Acc Id:
NM_001107607 ⟹ NP_001101077
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 243,980,746 - 244,033,629 (+) NCBI mRatBN7.2 1 234,568,190 - 234,621,079 (+) NCBI Rnor_5.0 1 262,953,201 - 263,006,973 (+) NCBI RGSC_v3.4 1 241,112,141 - 241,164,804 (+) RGD Celera 1 231,660,758 - 231,713,638 (+) RGD
Sequence:
ATGTCTGGCCGCCGCTGCGCCGGCGGGGGCGCGGCCTGCTCGAGCGCGGTGGCGGAGGCCGTAGAGCCGTCCGCCCGCGAACTGTTCGAGGCTTGCCGCAACGGGGACGTAGAGCGAGTGAAGAGGCT
hide sequence
RefSeq Acc Id:
XM_039080633 ⟹ XP_038936561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 243,980,432 - 244,033,629 (+) NCBI mRatBN7.2 1 234,567,888 - 234,621,079 (+) NCBI
RefSeq Acc Id:
XM_039080634 ⟹ XP_038936562
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 243,980,432 - 244,033,629 (+) NCBI mRatBN7.2 1 234,567,888 - 234,621,079 (+) NCBI
RefSeq Acc Id:
XM_063265190 ⟹ XP_063121260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 243,980,432 - 244,033,629 (+) NCBI
RefSeq Acc Id:
NP_001101077 ⟸ NM_001107607
- UniProtKB:
A0A0G2JTB0 (UniProtKB/TrEMBL)
- Sequence:
MSGRRCAGGGAACSSAVAEAVEPSARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNARDNWNYTPL
hide sequence
RefSeq Acc Id:
XP_038936562 ⟸ XM_039080634
- Peptide Label:
isoform X2
- UniProtKB:
D3ZRP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936561 ⟸ XM_039080633
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000068637 ⟸ ENSRNOT00000079808
Ensembl Acc Id:
ENSRNOP00000073499 ⟸ ENSRNOT00000085497
RefSeq Acc Id:
XP_063121260 ⟸ XM_063265190
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Tnks2
tankyrase 2
LOC100910717
tankyrase-2-like
Data merged from RGD:6496922
737654 PROVISIONAL
2016-03-08
Tnks2
tankyrase 2
Tnks2
tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100910717
tankyrase-2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-04-30
Tnks2
tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2
Tnks2_predicted
tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Tnks2_predicted
tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
