Advanced Search (OLGA)

Gene: Rsrc1 (arginine and serine rich coiled-coil 1) Rattus norvegicus

Analyze

Symbol:

Rsrc1

Name:

arginine and serine rich coiled-coil 1

RGD ID:

1304968

Description:

Predicted to be involved in alternative mRNA splicing, via spliceosome and nucleocytoplasmic transport. Predicted to act upstream of or within RNA splicing and response to antibiotic. Predicted to be located in nuclear speck. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 70. Orthologous to human RSRC1 (arginine and serine rich coiled-coil 1); INTERACTS WITH (R,R,R)-alpha-tocopherol; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arginine/serine-rich coiled coil protein 1; arginine/serine-rich coiled-coil 1; arginine/serine-rich coiled-coil protein 1; LOC361956; RGD1304968; serine/Arginine-related protein 53; similar to RIKEN cDNA 1200013F24; SRrp53

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RSRC1 (arginine and serine rich coiled-coil 1)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Rsrc1 (arginine/serine-rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rsrc1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RSRC1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RSRC1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rsrc1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RSRC1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RSRC1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rsrc1 (arginine and serine rich coiled-coil 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rsrc1 (arginine/serine-rich coiled-coil 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rsrc1 (arginine/serine-rich coiled-coil 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RSRC1 (arginine and serine rich coiled-coil 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RSRC1 (arginine and serine rich coiled-coil 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rsrc1 (arginine/serine-rich coiled-coil 1)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11808	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	rsrc1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rsrc1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	153,536,839 - 153,942,825 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	153,541,161 - 153,942,824 (+)	Ensembl				GRCr8
mRatBN7.2	2	151,226,821 - 151,632,771 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	151,231,156 - 151,632,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	158,363,261 - 158,749,524 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	156,413,751 - 156,800,020 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	151,046,502 - 151,432,770 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	164,126,898 - 164,533,652 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	2	183,573,497 - 183,803,891 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	183,478,536 - 183,493,424 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	183,840,728 - 183,881,362 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	156,889,768 - 157,213,294 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	145,605,752 - 146,001,649 (+)	NCBI		Celera
RGSC_v3.1	2	156,839,730 - 157,163,255 (+)	NCBI
Cytogenetic Map	2	q31-q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

autosomal recessive intellectual developmental disorder 70 (ISO)

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R,R,R)-alpha-tocopherol (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

alpha-pinene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cisplatin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

Enterolactone (ISO)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

furan (EXP)

L-ascorbic acid (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

phenytoin (EXP)

quercetin (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (EXP)

sulfadimethoxine (EXP)

sulforaphane (EXP)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

torcetrapib (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

alternative mRNA splicing, via spliceosome (IBA,IEA,ISO)

mRNA processing (IEA)

mRNA splicing, via spliceosome (IEA,ISO,ISS)

nucleocytoplasmic transport (ISO,ISS)

protein phosphorylation (ISO)

response to antibiotic (ISO)

RNA splicing (IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

nuclear speck (IEA,ISO,ISS)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:15798186

Genomics

Comparative Map Data

Rsrc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	153,536,839 - 153,942,825 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	153,541,161 - 153,942,824 (+)	Ensembl				GRCr8
mRatBN7.2	2	151,226,821 - 151,632,771 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	151,231,156 - 151,632,765 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	158,363,261 - 158,749,524 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	156,413,751 - 156,800,020 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	151,046,502 - 151,432,770 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	164,126,898 - 164,533,652 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	2	183,573,497 - 183,803,891 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	183,478,536 - 183,493,424 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	183,840,728 - 183,881,362 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	156,889,768 - 157,213,294 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	145,605,752 - 146,001,649 (+)	NCBI		Celera
RGSC_v3.1	2	156,839,730 - 157,163,255 (+)	NCBI
Cytogenetic Map	2	q31-q32	NCBI

RSRC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	158,110,089 - 158,545,730 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	158,105,675 - 158,545,734 (+)	Ensembl			hg38	GRCh38
GRCh37	3	157,827,878 - 158,263,519 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	159,310,586 - 159,745,276 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	156,251,731 - 156,686,586 (+)	NCBI		Celera
Cytogenetic Map	3	q25.32	NCBI
HuRef	3	155,224,606 - 155,659,537 (+)	NCBI		HuRef
CHM1_1	3	157,791,184 - 158,225,520 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	160,884,821 - 161,320,841 (+)	NCBI		T2T-CHM13v2.0

Rsrc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	66,888,694 - 67,265,736 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	66,888,723 - 67,265,729 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	66,981,364 - 67,358,403 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	66,981,390 - 67,358,396 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	66,789,594 - 67,162,325 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	67,073,648 - 67,446,326 (+)	NCBI		MGSCv36	mm8
Celera	3	67,121,233 - 67,492,320 (+)	NCBI		Celera
Cytogenetic Map	3	E1	NCBI
cM Map	3	30.77	NCBI

Rsrc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	8,951,336 - 9,326,257 (+)	Ensembl
ChiLan1.0	NW_004955448	8,947,553 - 9,249,465 (+)	NCBI	ChiLan1.0	ChiLan1.0

RSRC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	156,011,001 - 156,494,059 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	156,020,084 - 156,498,795 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	155,153,048 - 155,577,675 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	163,203,152 - 163,561,997 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	163,214,951 - 163,628,176 (+)	Ensembl			panPan2	panpan1.1

RSRC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	51,492,912 - 51,890,603 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	51,496,796 - 51,890,443 (+)	NCBI			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	51,365,386 - 51,552,785 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	52,135,295 - 52,532,041 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	52,135,225 - 52,533,115 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	51,714,234 - 52,034,656 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	51,767,196 - 52,164,677 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	52,053,398 - 52,450,017 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rsrc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	84,542,700 - 84,915,396 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	4,822,581 - 5,190,979 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	4,822,587 - 5,126,203 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RSRC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	97,893,851 - 98,333,700 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	97,893,815 - 98,338,108 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	106,088,366 - 106,580,705 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RSRC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	32,283,999 - 32,684,786 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	32,280,514 - 32,680,618 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	4,846,866 - 5,239,763 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rsrc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	35,859,016 - 36,257,205 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	35,835,430 - 36,257,416 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Rsrc1
3312 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	4
Count of miRNA genes:	4
Interacting mature miRNAs:	4
Transcripts:	ENSRNOT00000051977
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	124103798	154505346	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	145807215	190807215	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	150313808	195313808	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	143565208	188565208	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	139067258	192287892	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	120039407	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	139067258	184067258	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150096616	195096616	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	147287892	192287892	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	120339555	165339555	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149806826	170653323	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150096616	195096616	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	145807215	173074435	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat

Markers in Region

RH130005

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	151,630,749 - 151,630,957 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	164,531,631 - 164,531,838	NCBI	Rnor6.0
Rnor_5.0	2	183,881,125 - 183,881,332	UniSTS	Rnor5.0
RGSC_v3.4	2	157,213,057 - 157,213,264	UniSTS	RGSC3.4
Celera	2	146,001,412 - 146,001,619	UniSTS
RH 3.4 Map	2	997.1	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
7	1	18	52	67	138	95	11	51	36	32	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000101324 ⟹ ENSRNOP00000081280

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	153,541,161 - 153,942,824 (+)	Ensembl
mRatBN7.2 Ensembl	2	151,231,156 - 151,632,765 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112233 ⟹ ENSRNOP00000093787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	153,550,467 - 153,940,801 (+)	Ensembl
mRatBN7.2 Ensembl	2	151,231,196 - 151,630,747 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113236 ⟹ ENSRNOP00000096142

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	153,550,467 - 153,942,824 (+)	Ensembl
mRatBN7.2 Ensembl	2	151,240,449 - 151,632,765 (+)	Ensembl

RefSeq Acc Id:

NM_001014172 ⟹ NP_001014194

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	153,536,839 - 153,942,821 (+)	NCBI
mRatBN7.2	2	151,226,821 - 151,632,767 (+)	NCBI
Rnor_6.0	2	164,126,898 - 164,531,868 (+)	NCBI
Rnor_5.0	2	183,840,728 - 183,881,362 (+)	NCBI
Rnor_5.0	2	183,478,536 - 183,493,424 (+)	NCBI
Rnor_5.0	2	183,573,497 - 183,803,891 (+)	NCBI
RGSC_v3.4	2	156,889,768 - 157,213,294 (+)	RGD
Celera	2	145,605,752 - 146,001,649 (+)	RGD

Sequence:

show sequence

CGGACTGCCGGGCTGCTGCGGTCGTCGCGGCCCGGCTCGACGCAGCCGGGCTCTTTGGCCCCGC
GCAGCGGCCCGCTCTCCAGCACCTCCCGGTACGTGATGGCCTCCTTCTTCTCCTTCACTTTCTG
GTCAAAAGACTTGGAGACGAACGCCAAATGGGACGCCGGTCTTCAGACACTGAAGAAGAAAGCA
GAAGCAAGAGGAAAAAGAAACACAGGAGGCGGTCATCTTCAAGCAGCTCTTCAGACAGCAGGAC
GTACAGCCGCAAGAAGGGTGGGAGGAGGCCAAGGTCGGAGTCACGATCCTGGTCTAGAGACCGC
CAGCCTCGCTCACATTCTTATGAGAGAAGACGCAGGCGCAGGTCAAGCAGCAGCTCTTCTTATG
GCTCCAGAAGAAAACGCAGTCGCAGTCGTTCCAGGGGCCGAGGGAAGTCCTATAGAGTTCAGAG
GTCTCGGTCAAAAAGCAGAACAAGAAGGTCCAGGTCAAGACCTCGTCCACGCTCACATAGTAGA
AGCAGTGAAAGATCCAGTCACAGAAGAACTCGTAGTAGGTCCAGGGACAGAGACAGACGTAAAG
TTCGGGACAAAGAGAAGAGAGAAAAGGAGAAGGATAAAGGCAAAGACAAAGAGGCGCACACCAT
CAAACGCGGGGATTGTGGAAACATCAAAGCTGGATTAGAACATCTGCCTCCAGCTGAGCAGGCC
AAAGCCAGACTTCAATTGGTCCTTGAAGCTGCTGCAAAAGCTGATGAAGCATTAAAAGCCAAAG
AAAGGAATGAGGAAGAAGCAAAGAGAAGAAAAGAAGAAGACCAAGCCACCCTGGGAGAACAAGT
AAAAAGAGTAAAAGAAATCGAAGCAATTGAAAGTGATTCTTTTGTTCAGCAGACATTCAGATCA
AGTAAAGATGTCAAAAAGTCGGTAGAGCCGAGTGAGGTGAAGCATGTGACTCCAGCCTCAGGAC
CAGCATCAGTAGCTGCTGACCCACCCAGCACTGGAAAGGAAATAGACCCTGACAGCATCCCCAC
GGCTATCAAGTACCAAGATGACAATTCTCTAGCTCATCCAAATTTATTTATTGAAAAAGCTGAA
GCTGAGGAAAAGTGGTTCAAGAGATTGATTGCTCTCCGACAAGAAAGATTGATGGGCAGTCCTG
TGGCCTAAGCAGTAGACTTACGGTCGGATTGACAGGAAGCTTGAAAACTTAGGTTTTAAATACC
AACATTAACTTTTACTCTCAAAAAATAGCTTAGCCAATTACATGAAAAAAGAAAACTCATTTCT
TCCCTCGTGTTCAACTAAATATTTGGTAACTTGAATCAAACATTGTGGATAGTGAATCTGTTAT
AAACGTGCTGAGGCATGAACATATTATACTGTTAATAAAGCAAATAATAAAAATAAAAAAAAAA
AAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

XM_039102629 ⟹ XP_038958557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	153,541,151 - 153,942,825 (+)	NCBI
mRatBN7.2	2	151,231,123 - 151,632,771 (+)	NCBI

RefSeq Acc Id:

XM_063282106 ⟹ XP_063138176

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	153,541,150 - 153,942,825 (+)	NCBI

RefSeq Acc Id:

XM_063282107 ⟹ XP_063138177

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	153,536,856 - 153,942,825 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014194	(Get FASTA)	NCBI Sequence Viewer
	XP_038958557	(Get FASTA)	NCBI Sequence Viewer
	XP_063138176	(Get FASTA)	NCBI Sequence Viewer
	XP_063138177	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87665	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081280
	ENSRNOP00000081280.1
	ENSRNOP00000096142
GenBank Protein	Q5PPJ2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014194 ⟸ NM_001014172

- UniProtKB:

Q5PPJ2 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSESRSWSRDRQPRSHSYER
RRRRRSSSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRR
TRSRSRDRDRRKVRDKEKREKEKDKGKDKEAHTIKRGDCGNIKAGLEHLPPAEQAKARLQLVLE
AAAKADEALKAKERNEEEAKRRKEEDQATLGEQVKRVKEIEAIESDSFVQQTFRSSKDVKKSVE
PSEVKHVTPASGPASVAADPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRL
IALRQERLMGSPVA

hide sequence

RefSeq Acc Id:	XP_038958557 ⟸ XM_039102629
- Peptide Label:	isoform X1
- UniProtKB:	Q5PPJ2 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000081280 ⟸ ENSRNOT00000101324

Ensembl Acc Id:

ENSRNOP00000096142 ⟸ ENSRNOT00000113236

Ensembl Acc Id:

ENSRNOP00000093787 ⟸ ENSRNOT00000112233

RefSeq Acc Id:	XP_063138177 ⟸ XM_063282107
- Peptide Label:	isoform X1
- UniProtKB:	Q5PPJ2 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063138176 ⟸ XM_063282106
- Peptide Label:	isoform X1
- UniProtKB:	Q5PPJ2 (UniProtKB/Swiss-Prot)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PPJ2-F1-model_v2	AlphaFold	Q5PPJ2	1-334	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304968	AgrOrtholog
BioCyc Gene	G2FUF-52871	BioCyc
Ensembl Genes	ENSRNOG00000062777	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000101324	ENTREZGENE
	ENSRNOT00000101324.1	UniProtKB/Swiss-Prot
	ENSRNOT00000113236	ENTREZGENE
IMAGE_CLONE	IMAGE:7317835	IMAGE-MGC_LOAD
InterPro	SRRP53	UniProtKB/Swiss-Prot
KEGG Report	rno:361956	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105761	IMAGE-MGC_LOAD
NCBI Gene	361956	ENTREZGENE
PANTHER	PTHR31968	UniProtKB/Swiss-Prot
	SERINE/ARGININE-RELATED PROTEIN 53	UniProtKB/Swiss-Prot
PhenoGen	Rsrc1	PhenoGen
RatGTEx	ENSRNOG00000062777	RatGTEx
UniProt	A0A8I6AQ68_RAT	UniProtKB/TrEMBL
	A0A8I6AXI9_RAT	UniProtKB/TrEMBL
	Q5PPJ2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-15	Rsrc1	arginine and serine rich coiled-coil 1	Rsrc1	arginine/serine-rich coiled-coil 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Rsrc1	arginine/serine-rich coiled-coil 1	RGD1304968	similar to RIKEN cDNA 1200013F24	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1304968	similar to RIKEN cDNA 1200013F24	RGD1304968_predicted	similar to RIKEN cDNA 1200013F24 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1304968_predicted	similar to RIKEN cDNA 1200013F24 (predicted)	LOC361956_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361956_predicted	similar to RIKEN cDNA 1200013F24 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM