Symbol:
Hipk1
Name:
homeodomain interacting protein kinase 1
RGD ID:
1304941
Description:
Predicted to enable protein serine/threonine kinase activity and protein tyrosine kinase activity. Predicted to be involved in several processes, including apoptotic signaling pathway; camera-type eye morphogenesis; and endothelial cell apoptotic process. Predicted to act upstream of or within anterior/posterior pattern specification and positive regulation of cell population proliferation. Predicted to be located in cytosol; microtubule organizing center; and nuclear speck. Predicted to be active in PML body and cytoplasm. Orthologous to human HIPK1 (homeodomain interacting protein kinase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
homeodomain-interacting protein kinase 1; LOC365895
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 193,937,261 - 193,988,247 (-) NCBI GRCr8 mRatBN7.2 2 191,248,817 - 191,299,787 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 191,248,817 - 191,298,902 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 198,845,877 - 198,895,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 196,718,605 - 196,768,588 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 191,535,577 - 191,585,560 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 206,224,015 - 206,274,910 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 206,224,015 - 206,274,079 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 225,647,725 - 225,698,674 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 198,963,076 - 199,014,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 198,929,617 - 198,977,395 (-) NCBI Celera 2 183,720,653 - 183,770,661 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hipk1 Rat (S)-nicotine multiple interactions ISO Hipk1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hipk1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Hipk1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hipk1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Hipk1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hipk1 Rat 17beta-estradiol affects expression ISO HIPK1 (Homo sapiens) 6480464 Estradiol affects the expression of HIPK1 mRNA CTD PMID:22574217 Hipk1 Rat 17beta-estradiol decreases expression ISO Hipk1 (Mus musculus) 6480464 Estradiol results in decreased expression of HIPK1 mRNA CTD PMID:39298647 Hipk1 Rat 17beta-estradiol increases expression ISO HIPK1 (Homo sapiens) 6480464 Estradiol results in increased expression of HIPK1 mRNA CTD PMID:23019147 Hipk1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hipk1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HIPK1 mRNA CTD PMID:21570461 Hipk1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HIPK1 mRNA CTD PMID:33387578 Hipk1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HIPK1 mRNA CTD PMID:34747641 Hipk1 Rat 2-palmitoylglycerol increases expression ISO HIPK1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of HIPK1 mRNA CTD PMID:37199045 Hipk1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIPK1 mRNA CTD PMID:28628672 Hipk1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Hipk1 (Mus musculus) 6480464 bisphenol S results in decreased expression of HIPK1 mRNA CTD PMID:39298647 Hipk1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of HIPK1 mRNA CTD PMID:24780913 Hipk1 Rat all-trans-retinoic acid decreases expression ISO HIPK1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HIPK1 mRNA CTD PMID:15498508 Hipk1 Rat amphotericin B decreases expression ISO HIPK1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of HIPK1 mRNA CTD PMID:28534445 Hipk1 Rat Aroclor 1254 decreases expression ISO Hipk1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HIPK1 mRNA CTD PMID:23650126 Hipk1 Rat arsane affects methylation ISO HIPK1 (Homo sapiens) 6480464 Arsenic affects the methylation of HIPK1 gene CTD PMID:25304211 Hipk1 Rat arsane multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA CTD PMID:39836092 Hipk1 Rat arsenic atom affects methylation ISO HIPK1 (Homo sapiens) 6480464 Arsenic affects the methylation of HIPK1 gene CTD PMID:25304211 Hipk1 Rat arsenic atom multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA CTD PMID:39836092 Hipk1 Rat arsenite(3-) affects expression ISO HIPK1 (Homo sapiens) 6480464 arsenite affects the expression of HIPK1 mRNA CTD PMID:22959463 Hipk1 Rat arsenite(3-) multiple interactions ISO HIPK1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to HIPK1 mRNA] CTD PMID:32406909 Hipk1 Rat arsenous acid increases expression ISO HIPK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HIPK1 mRNA CTD PMID:20458559 Hipk1 Rat benzo[a]pyrene decreases methylation ISO HIPK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of HIPK1 5' UTR CTD PMID:27901495 Hipk1 Rat benzo[a]pyrene affects methylation ISO HIPK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HIPK1 3' UTR CTD PMID:27901495 Hipk1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO HIPK1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Hipk1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HIPK1 mRNA CTD PMID:25181051 Hipk1 Rat bisphenol A multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HIPK1 gene CTD PMID:31601247 Hipk1 Rat bisphenol F multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIPK1 mRNA CTD PMID:28628672 Hipk1 Rat cadmium dichloride decreases expression ISO HIPK1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HIPK1 mRNA CTD PMID:38568856 Hipk1 Rat CGP 52608 multiple interactions ISO HIPK1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HIPK1 gene] CTD PMID:28238834 Hipk1 Rat cobalt dichloride increases expression ISO HIPK1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of HIPK1 mRNA CTD PMID:19320972 Hipk1 Rat copper(II) sulfate increases expression ISO HIPK1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of HIPK1 mRNA CTD PMID:19549813 Hipk1 Rat coumarin decreases phosphorylation ISO HIPK1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of HIPK1 protein CTD PMID:35688186 Hipk1 Rat coumestrol decreases expression ISO HIPK1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of HIPK1 mRNA CTD PMID:19167446 Hipk1 Rat cyclosporin A increases expression ISO HIPK1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HIPK1 mRNA CTD PMID:25562108 Hipk1 Rat dexamethasone multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIPK1 mRNA CTD PMID:28628672 Hipk1 Rat diarsenic trioxide increases expression ISO HIPK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HIPK1 mRNA CTD PMID:20458559 Hipk1 Rat Dibutyl phosphate affects expression ISO HIPK1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HIPK1 mRNA CTD PMID:37042841 Hipk1 Rat dibutyl phthalate increases expression ISO Hipk1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of HIPK1 mRNA CTD PMID:21266533 Hipk1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of HIPK1 mRNA CTD PMID:22546817 Hipk1 Rat doxorubicin increases expression ISO Hipk1 (Mus musculus) 6480464 Doxorubicin results in increased expression of HIPK1 mRNA CTD PMID:25896364 Hipk1 Rat ethanol affects expression ISO Hipk1 (Mus musculus) 6480464 Ethanol affects the expression of HIPK1 mRNA CTD PMID:30319688 Hipk1 Rat ethanol affects splicing ISO Hipk1 (Mus musculus) 6480464 Ethanol affects the splicing of HIPK1 mRNA CTD PMID:30319688 Hipk1 Rat fenthion decreases expression ISO Hipk1 (Mus musculus) 6480464 Fenthion results in decreased expression of HIPK1 mRNA CTD PMID:34813904 Hipk1 Rat FR900359 decreases phosphorylation ISO HIPK1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of HIPK1 protein CTD PMID:37730182 Hipk1 Rat fulvestrant multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HIPK1 gene CTD PMID:31601247 Hipk1 Rat indometacin multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HIPK1 mRNA CTD PMID:28628672 Hipk1 Rat isoprenaline increases expression ISO Hipk1 (Mus musculus) 6480464 Isoproterenol results in increased expression of HIPK1 mRNA CTD PMID:20003209 Hipk1 Rat lipopolysaccharide increases expression ISO HIPK1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of HIPK1 protein CTD PMID:36052886 Hipk1 Rat lipopolysaccharide multiple interactions ISO HIPK1 (Homo sapiens) 6480464 HIPK1 protein inhibits the reaction [MIR335 mRNA inhibits the reaction [Lipopolysaccharides results in decreased expression of CCND1 protein]] more ... CTD PMID:36052886 Hipk1 Rat manganese atom multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA CTD PMID:39836092 Hipk1 Rat manganese(0) multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA CTD PMID:39836092 Hipk1 Rat manganese(II) chloride multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA CTD PMID:39836092 Hipk1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of HIPK1 mRNA CTD PMID:30467583 Hipk1 Rat methidathion decreases expression ISO Hipk1 (Mus musculus) 6480464 methidathion results in decreased expression of HIPK1 mRNA CTD PMID:34813904 Hipk1 Rat methyl methanesulfonate increases expression ISO HIPK1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of HIPK1 mRNA CTD PMID:23649840 Hipk1 Rat motexafin gadolinium multiple interactions ISO HIPK1 (Homo sapiens) 6480464 motexafin gadolinium affects the reaction [Zinc Acetate results in increased expression of HIPK1 mRNA] CTD PMID:16357179 Hipk1 Rat motexafin gadolinium increases expression ISO HIPK1 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of HIPK1 mRNA CTD PMID:16357179 Hipk1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of HIPK1 mRNA CTD PMID:22546817 Hipk1 Rat nicotine multiple interactions ISO Hipk1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Hipk1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HIPK1 mRNA CTD PMID:25729387 Hipk1 Rat paracetamol increases expression ISO Hipk1 (Mus musculus) 6480464 Acetaminophen results in increased expression of HIPK1 mRNA CTD PMID:17585979 Hipk1 Rat paracetamol affects expression ISO Hipk1 (Mus musculus) 6480464 Acetaminophen affects the expression of HIPK1 mRNA CTD PMID:17562736 Hipk1 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of HIPK1 mRNA CTD PMID:25905778 Hipk1 Rat sodium arsenite multiple interactions ISO HIPK1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of HIPK1 mRNA more ... CTD PMID:27884605 and PMID:39836092 Hipk1 Rat sodium arsenite increases expression ISO HIPK1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HIPK1 mRNA CTD PMID:38568856 Hipk1 Rat sunitinib increases expression ISO HIPK1 (Homo sapiens) 6480464 Sunitinib results in increased expression of HIPK1 mRNA CTD PMID:31533062 Hipk1 Rat tamibarotene decreases expression ISO HIPK1 (Homo sapiens) 6480464 tamibarotene results in decreased expression of HIPK1 mRNA CTD PMID:15498508 Hipk1 Rat testosterone enanthate affects expression ISO HIPK1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of HIPK1 mRNA CTD PMID:17440010 Hipk1 Rat thiram increases expression ISO HIPK1 (Homo sapiens) 6480464 Thiram results in increased expression of HIPK1 mRNA CTD PMID:38568856 Hipk1 Rat titanium dioxide affects expression ISO Hipk1 (Mus musculus) 6480464 titanium dioxide affects the expression of HIPK1 mRNA CTD PMID:17656681 Hipk1 Rat titanium dioxide decreases methylation ISO Hipk1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HIPK1 gene and titanium dioxide results in decreased methylation of HIPK1 promoter CTD PMID:35295148 Hipk1 Rat titanium dioxide decreases expression ISO Hipk1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of HIPK1 mRNA CTD PMID:29264374 Hipk1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of HIPK1 mRNA CTD PMID:25729387 Hipk1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of HIPK1 mRNA CTD PMID:25729387 Hipk1 Rat triptonide decreases expression ISO Hipk1 (Mus musculus) 6480464 triptonide results in decreased expression of HIPK1 mRNA CTD PMID:33045310 Hipk1 Rat tungsten decreases expression ISO Hipk1 (Mus musculus) 6480464 Tungsten results in decreased expression of HIPK1 mRNA CTD PMID:30912803 Hipk1 Rat urethane increases expression ISO HIPK1 (Homo sapiens) 6480464 Urethane results in increased expression of HIPK1 mRNA CTD PMID:28818685 Hipk1 Rat valproic acid decreases expression ISO Hipk1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of HIPK1 mRNA CTD PMID:19136453 Hipk1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of HIPK1 mRNA CTD PMID:29427782 Hipk1 Rat valproic acid decreases methylation ISO HIPK1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of HIPK1 gene CTD PMID:29154799 Hipk1 Rat valproic acid decreases expression ISO HIPK1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HIPK1 mRNA CTD PMID:23179753 Hipk1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of HIPK1 mRNA CTD PMID:23869203 Hipk1 Rat zinc acetate increases expression ISO HIPK1 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of HIPK1 mRNA CTD PMID:16357179 Hipk1 Rat zinc acetate multiple interactions ISO HIPK1 (Homo sapiens) 6480464 motexafin gadolinium affects the reaction [Zinc Acetate results in increased expression of HIPK1 mRNA] CTD PMID:16357179
(S)-nicotine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) amphotericin B (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dieldrin (EXP) doxorubicin (ISO) ethanol (ISO) fenthion (ISO) FR900359 (ISO) fulvestrant (ISO) indometacin (ISO) isoprenaline (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) methidathion (ISO) methyl methanesulfonate (ISO) motexafin gadolinium (ISO) nickel dichloride (EXP) nicotine (ISO) oxaliplatin (EXP) paracetamol (ISO) resveratrol (EXP) sodium arsenite (ISO) sunitinib (ISO) tamibarotene (ISO) testosterone enanthate (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) zinc acetate (ISO)
Biological Process
adherens junction assembly (IEA,ISO) anterior/posterior pattern specification (IEA,ISO) cell population proliferation (IEA,ISO) embryonic camera-type eye morphogenesis (IEA,ISO) embryonic retina morphogenesis in camera-type eye (IEA,ISO) endothelial cell apoptotic process (IEA,ISO) extrinsic apoptotic signaling pathway (IEA,ISO) intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (IBA,IEA,ISO) iris morphogenesis (IEA,ISO) lens induction in camera-type eye (IEA,ISO) neuron differentiation (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) protein phosphorylation (ISO) regulation of tumor necrosis factor-mediated signaling pathway (IEA,ISO) retina layer formation (IEA,ISO) smoothened signaling pathway (IBA,IEA,ISO)
Cellular Component
centrosome (IEA,ISO) ciliary basal body (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytosol (IEA,ISO) nuclear speck (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) PML body (IBA,IEA,ISO)
Hipk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 193,937,261 - 193,988,247 (-) NCBI GRCr8 mRatBN7.2 2 191,248,817 - 191,299,787 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 191,248,817 - 191,298,902 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 198,845,877 - 198,895,860 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 196,718,605 - 196,768,588 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 191,535,577 - 191,585,560 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 206,224,015 - 206,274,910 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 206,224,015 - 206,274,079 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 225,647,725 - 225,698,674 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 198,963,076 - 199,014,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 198,929,617 - 198,977,395 (-) NCBI Celera 2 183,720,653 - 183,770,661 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
HIPK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 113,929,324 - 113,977,869 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 113,929,324 - 113,977,869 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 114,471,946 - 114,520,491 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 114,273,519 - 114,321,945 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 112,701,213 - 112,749,655 (+) NCBI Celera Cytogenetic Map 1 p13.2 NCBI HuRef 1 112,330,056 - 112,378,556 (+) NCBI HuRef CHM1_1 1 114,586,835 - 114,635,335 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 113,940,985 - 113,989,530 (+) NCBI T2T-CHM13v2.0
Hipk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 103,647,131 - 103,699,210 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 103,647,131 - 103,698,879 (-) Ensembl GRCm39 Ensembl GRCm38 3 103,739,815 - 103,791,894 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 103,739,815 - 103,791,563 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 103,543,738 - 103,595,198 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 103,872,732 - 103,920,240 (-) NCBI MGSCv36 mm8 MGSCv36 3 103,853,833 - 103,900,424 (-) NCBI MGSCv36 mm8 Celera 3 105,941,903 - 105,994,105 (-) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 45.52 NCBI
Hipk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 17,172,651 - 17,257,371 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 17,201,866 - 17,257,371 (+) NCBI ChiLan1.0 ChiLan1.0
HIPK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 106,587,929 - 106,636,756 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 106,181,332 - 106,230,139 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 88,579,603 - 88,627,988 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 123,629,271 - 123,677,714 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 123,633,134 - 123,677,714 (-) Ensembl panpan1.1 panPan2
HIPK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 51,732,079 - 51,783,534 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 51,732,016 - 51,781,063 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 51,383,446 - 51,434,833 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 52,610,377 - 52,661,859 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 52,610,173 - 52,661,830 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 51,617,630 - 51,668,969 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 51,685,923 - 51,737,304 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 52,258,450 - 52,309,908 (+) NCBI UU_Cfam_GSD_1.0
Hipk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 15,124,279 - 15,211,810 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936690 2,265,849 - 2,353,485 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 Ensembl NW_004936690 2,265,849 - 2,274,199 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936690 2,293,740 - 2,353,450 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HIPK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 106,572,755 - 106,627,418 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 106,570,950 - 106,627,114 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 116,708,471 - 116,742,456 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HIPK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 19,680,952 - 19,731,503 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 19,680,778 - 19,730,129 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 22,451,246 - 22,500,359 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hipk1
.
Predicted Target Of
Count of predictions: 1419 Count of miRNA genes: 353 Interacting mature miRNAs: 505 Transcripts: ENSRNOT00000056079 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 10043139 Iddm55 Insulin dependent diabetes mellitus QTL 55 3.1 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 190602746 192625452 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
RH139604
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 191,249,331 - 191,249,540 (+) MAPPER mRatBN7.2 Rnor_6.0 2 206,224,530 - 206,224,738 NCBI Rnor6.0 Rnor_5.0 2 225,648,240 - 225,648,448 UniSTS Rnor5.0 RGSC_v3.4 2 198,963,591 - 198,963,799 UniSTS RGSC3.4 Celera 2 183,721,168 - 183,721,376 UniSTS RH 3.4 Map 2 1326.6 UniSTS Cytogenetic Map 2 q34 UniSTS
SHGC-16738
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 191,248,825 - 191,248,972 (+) MAPPER mRatBN7.2 Rnor_6.0 2 206,224,024 - 206,224,170 NCBI Rnor6.0 Rnor_5.0 2 225,647,734 - 225,647,880 UniSTS Rnor5.0 RGSC_v3.4 2 198,963,085 - 198,963,231 UniSTS RGSC3.4 Celera 2 183,720,662 - 183,720,808 UniSTS Cytogenetic Map 2 q34 UniSTS
RH143441
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 191,249,105 - 191,249,355 (+) MAPPER mRatBN7.2 Rnor_6.0 2 206,224,304 - 206,224,553 NCBI Rnor6.0 Rnor_5.0 2 225,648,014 - 225,648,263 UniSTS Rnor5.0 RGSC_v3.4 2 198,963,365 - 198,963,614 UniSTS RGSC3.4 Celera 2 183,720,942 - 183,721,191 UniSTS RH 3.4 Map 2 1326.6 UniSTS Cytogenetic Map 2 q34 UniSTS
RH144541
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 191,299,282 - 191,299,460 (+) MAPPER mRatBN7.2 Rnor_6.0 2 206,274,460 - 206,274,637 NCBI Rnor6.0 Rnor_5.0 2 225,698,170 - 225,698,347 UniSTS Rnor5.0 RGSC_v3.4 2 199,015,091 - 199,015,268 UniSTS RGSC3.4 Celera 2 183,771,042 - 183,771,219 UniSTS RH 3.4 Map 2 1327.9 UniSTS Cytogenetic Map 2 q34 UniSTS
RH136831
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 191,249,515 - 191,249,660 (+) MAPPER mRatBN7.2 Rnor_6.0 2 206,224,714 - 206,224,858 NCBI Rnor6.0 Rnor_5.0 2 225,648,424 - 225,648,568 UniSTS Rnor5.0 RGSC_v3.4 2 198,963,775 - 198,963,919 UniSTS RGSC3.4 Celera 2 183,721,352 - 183,721,496 UniSTS RH 3.4 Map 2 1326.7 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056079 ⟹ ENSRNOP00000061079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 191,248,817 - 191,298,902 (-) Ensembl Rnor_6.0 Ensembl 2 206,224,015 - 206,274,079 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096033 ⟹ ENSRNOP00000077809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 191,248,817 - 191,298,902 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113978 ⟹ ENSRNOP00000083225
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 191,248,826 - 191,298,902 (-) Ensembl
RefSeq Acc Id:
NM_001100986 ⟹ NP_001094456
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,344 (-) NCBI mRatBN7.2 2 191,248,817 - 191,298,902 (-) NCBI Rnor_6.0 2 206,224,015 - 206,274,079 (-) NCBI Rnor_5.0 2 225,647,725 - 225,698,674 (-) NCBI RGSC_v3.4 2 198,963,076 - 199,014,710 (-) RGD Celera 2 183,720,653 - 183,770,661 (-) RGD
Sequence:
GCGGGAGGCTGGCGAGACTCCGGCCGCAGGACGGGCGCGGGGACGGCTCCGGGGGGCGGGGGCCGGGGCCCGGGCCGGCTCGTGCGGGGGGTATGATGACCCGGCGGCGGGGCCCCGGATCGCCTCTC
hide sequence
RefSeq Acc Id:
XM_008761420 ⟹ XP_008759642
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,292 (-) NCBI mRatBN7.2 2 191,248,817 - 191,298,896 (-) NCBI Rnor_6.0 2 206,224,015 - 206,274,283 (-) NCBI
Sequence:
GTCATGGCGCTAGGTGGCTGAATGGTTCCGGCGAGGCGGGGCCGTCGGGATGAAGGCAGTTGCT
hide sequence
RefSeq Acc Id:
XM_039102788 ⟹ XP_038958716
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,292 (-) NCBI mRatBN7.2 2 191,248,817 - 191,298,850 (-) NCBI
RefSeq Acc Id:
XM_039102789 ⟹ XP_038958717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,296 (-) NCBI mRatBN7.2 2 191,248,817 - 191,298,854 (-) NCBI
RefSeq Acc Id:
XM_039102792 ⟹ XP_038958720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI mRatBN7.2 2 191,248,817 - 191,286,719 (-) NCBI
RefSeq Acc Id:
XM_039102793 ⟹ XP_038958721
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI mRatBN7.2 2 191,248,817 - 191,286,719 (-) NCBI
RefSeq Acc Id:
XM_039102794 ⟹ XP_038958722
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI mRatBN7.2 2 191,248,817 - 191,286,719 (-) NCBI
RefSeq Acc Id:
XM_039102795 ⟹ XP_038958723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,968,959 (-) NCBI mRatBN7.2 2 191,248,817 - 191,280,736 (-) NCBI
RefSeq Acc Id:
XM_063282279 ⟹ XP_063138349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI
RefSeq Acc Id:
XM_063282280 ⟹ XP_063138350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI
RefSeq Acc Id:
XM_063282282 ⟹ XP_063138352
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,977,454 (-) NCBI
RefSeq Acc Id:
XM_063282283 ⟹ XP_063138353
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,901 (-) NCBI
RefSeq Acc Id:
XM_063282284 ⟹ XP_063138354
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI
RefSeq Acc Id:
XM_063282285 ⟹ XP_063138355
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,907 (-) NCBI
RefSeq Acc Id:
XM_063282286 ⟹ XP_063138356
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,902 (-) NCBI
RefSeq Acc Id:
XM_063282287 ⟹ XP_063138357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,988,247 (-) NCBI
RefSeq Acc Id:
XM_063282288 ⟹ XP_063138358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,937,261 - 193,987,726 (-) NCBI
RefSeq Acc Id:
XM_063282289 ⟹ XP_063138359
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,942,724 - 193,987,292 (-) NCBI
RefSeq Acc Id:
XR_005500331
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,951,160 - 193,988,247 (-) NCBI mRatBN7.2 2 191,262,716 - 191,286,719 (-) NCBI
RefSeq Acc Id:
XR_010063633
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 193,951,160 - 193,988,247 (-) NCBI
RefSeq Acc Id:
NP_001094456 ⟸ NM_001100986
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot), F1M8I6 (UniProtKB/TrEMBL)
- Sequence:
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNIPAYDQGLLLQAPAVEHIVVTAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSE
hide sequence
RefSeq Acc Id:
XP_008759642 ⟸ XM_008761420
- Peptide Label:
isoform X8
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
- Sequence:
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVAN
hide sequence
Ensembl Acc Id:
ENSRNOP00000061079 ⟸ ENSRNOT00000056079
RefSeq Acc Id:
XP_038958717 ⟸ XM_039102789
- Peptide Label:
isoform X3
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958716 ⟸ XM_039102788
- Peptide Label:
isoform X3
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958722 ⟸ XM_039102794
- Peptide Label:
isoform X11
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958720 ⟸ XM_039102792
- Peptide Label:
isoform X5
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958721 ⟸ XM_039102793
- Peptide Label:
isoform X10
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958723 ⟸ XM_039102795
- Peptide Label:
isoform X13
Ensembl Acc Id:
ENSRNOP00000077809 ⟸ ENSRNOT00000096033
Ensembl Acc Id:
ENSRNOP00000083225 ⟸ ENSRNOT00000113978
RefSeq Acc Id:
XP_063138357 ⟸ XM_063282287
- Peptide Label:
isoform X9
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138354 ⟸ XM_063282284
- Peptide Label:
isoform X6
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138350 ⟸ XM_063282280
- Peptide Label:
isoform X2
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138349 ⟸ XM_063282279
- Peptide Label:
isoform X1
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138355 ⟸ XM_063282285
- Peptide Label:
isoform X7
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138356 ⟸ XM_063282286
- Peptide Label:
isoform X8
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138353 ⟸ XM_063282283
- Peptide Label:
isoform X4
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot), F1M8I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138358 ⟸ XM_063282288
- Peptide Label:
isoform X3
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138352 ⟸ XM_063282282
- Peptide Label:
isoform X3
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063138359 ⟸ XM_063282289
- Peptide Label:
isoform X12
- UniProtKB:
A4L9P6 (UniProtKB/Swiss-Prot), A4L9P5 (UniProtKB/Swiss-Prot)
RGD ID: 13691629 Promoter ID: EPDNEW_R2154 Type: initiation region Name: Hipk1_1 Description: homeodomain interacting protein kinase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 206,274,153 - 206,274,213 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Hipk1
homeodomain interacting protein kinase 1
Hipk1_predicted
homeodomain interacting protein kinase 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Hipk1_predicted
homeodomain interacting protein kinase 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
