Advanced Search (OLGA)

Gene: Cadm4 (cell adhesion molecule 4) Rattus norvegicus

Analyze

Symbol:

Cadm4

Name:

cell adhesion molecule 4

RGD ID:

1304722

Description:

Predicted to enable enzyme binding activity and vascular endothelial growth factor receptor binding activity. Involved in synaptic membrane adhesion. Is active in synaptic membrane. Orthologous to human CADM4 (cell adhesion molecule 4); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; acetamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Igsf4c; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; LOC365216; Necl-4; nectin-like protein 4; Upar; urokinase plasminogen activator receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CADM4 (cell adhesion molecule 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNF222 (ring finger protein 222)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CADM4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cadm4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cadm4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr16	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr19	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr15	Alliance	DIOPT (InParanoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cadm4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cadm4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Fas3	Alliance	DIOPT (Ensembl Compara\|Hieranoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	89,202,554 - 89,225,345 (+)	Ensembl				GRCr8
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	85,468,817 - 85,490,110 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,018,691 - 94,039,966 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,224,638 - 87,245,935 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	74,528,342 - 74,549,564 (+)	NCBI		Celera
RGSC_v3.1	1	79,768,363 - 79,868,066 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

alpha-Zearalanol (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

dichloroacetic acid (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

isoprenaline (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

panobinostat (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell adhesion (IEA)

homophilic cell-cell adhesion (IBA)

negative regulation of peptidyl-threonine phosphorylation (ISO,ISS)

negative regulation of peptidyl-tyrosine phosphorylation (ISO,ISS)

negative regulation of protein phosphorylation (ISO)

negative regulation of vascular endothelial growth factor receptor signaling pathway (ISO,ISS)

negative regulation of vascular endothelial growth factor signaling pathway (ISO,ISS)

regulation of cell motility (ISO,ISS)

regulation of cell population proliferation (ISO,ISS)

regulation of protein phosphorylation (ISO)

regulation of Rac protein signal transduction (IBA,ISO,ISS)

regulation of wound healing (IBA,ISO,ISS)

synaptic membrane adhesion (IDA,IEP,IMP,NAS)

Cellular Component

cell leading edge (ISO,ISS)

cell-cell contact zone (IBA,ISO,ISS)

membrane (IEA)

synapse (IEA)

synaptic membrane (IDA,IEP)

Molecular Function

protein binding (ISO)

protein phosphatase binding (ISO)

receptor tyrosine kinase binding (ISO)

vascular endothelial growth factor receptor 1 binding (ISO)

vascular endothelial growth factor receptor 2 binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	SynCAMs organize synapses through heterophilic adhesion.	Fogel AI, etal., J Neurosci. 2007 Nov 14;27(46):12516-30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17558405	PMID:17724124	PMID:23376485	PMID:23611113	PMID:25893857	PMID:28119456	PMID:29476059

Genomics

Comparative Map Data

Cadm4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	89,202,554 - 89,225,345 (+)	Ensembl				GRCr8
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	85,468,817 - 85,490,110 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,018,691 - 94,039,966 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,224,638 - 87,245,935 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	74,528,342 - 74,549,564 (+)	NCBI		Celera
RGSC_v3.1	1	79,768,363 - 79,868,066 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

CADM4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	43,622,368 - 43,641,984 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	43,622,366 - 43,639,850 (-)	Ensembl			hg38	GRCh38
GRCh37	19	44,126,520 - 44,144,002 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	48,818,362 - 48,835,831 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	48,818,361 - 48,835,831	NCBI
Celera	19	40,929,016 - 40,946,485 (-)	NCBI		Celera
Cytogenetic Map	19	q13.31	NCBI
HuRef	19	40,557,289 - 40,562,715 (-)	NCBI		HuRef
CHM1_1	19	44,128,270 - 44,133,697 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	46,444,027 - 46,463,643 (-)	NCBI		T2T-CHM13v2.0

Cadm4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	24,181,448 - 24,203,958 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	24,181,448 - 24,203,964 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	24,482,023 - 24,504,533 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	24,482,023 - 24,504,539 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	25,267,042 - 25,289,552 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	24,190,859 - 24,213,187 (+)	NCBI		MGSCv36	mm8
Celera	7	19,096,111 - 19,118,626 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	11.03	NCBI

Cadm4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	1,356,143 - 1,368,480 (-)	Ensembl
ChiLan1.0	NW_004955555	1,356,143 - 1,361,404 (-)	NCBI	ChiLan1.0	ChiLan1.0

CADM4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	49,781,407 - 49,798,930 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	51,636,125 - 51,668,041 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	40,564,288 - 40,581,830 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1 Ensembl	19	49,172,485 - 49,180,023 (-)	Ensembl			panPan2	panpan1.1

CADM4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	111,507,543 - 111,512,733 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	111,507,543 - 111,513,308 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	110,977,797 - 110,992,457 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	112,108,192 - 112,122,853 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	112,108,175 - 112,122,852 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	111,696,331 - 111,710,988 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	111,330,179 - 111,344,834 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	112,214,399 - 112,229,059 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cadm4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	16,473,278 - 16,479,855 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	820,632 - 825,392 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	820,622 - 825,775 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CADM4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	50,462,450 - 50,478,383 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	50,462,439 - 50,478,409 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	46,217,364 - 46,327,475 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CADM4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	37,143,477 - 37,161,524 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	37,140,676 - 37,161,524 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	16,684,642 - 16,702,815 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cadm4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	1,152,645 - 1,168,589 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624907	1,152,063 - 1,168,587 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cadm4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	170,208,516 - 170,230,515 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cadm4
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	96
Count of miRNA genes:	78
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000026793
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	159	91	90	59	61	59	6	323	160	9	138	80	92	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ272745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026793 ⟹ ENSRNOP00000026793

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	89,203,089 - 89,225,345 (+)	Ensembl
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156668 ⟹ ENSRNOP00000112401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	89,202,554 - 89,225,345 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000164932 ⟹ ENSRNOP00000106428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	89,203,058 - 89,225,345 (+)	Ensembl

RefSeq Acc Id:

NM_001047107 ⟹ NP_001040572

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	RGD
Celera	1	74,528,342 - 74,549,564 (+)	RGD

Sequence:

show sequence

ATGGGCCGGGCCCGGCGCTTCCAGTGGCCGCTGCTGCTACTGTGGGCGGCCGCGGCGGGGCCAG
GGACGGCACAGGAAGTGCAGACAGAGAATGTGACGGTGGCCGAGGGTGGGGTGGCTGAGATCAC
CTGCCGTCTGCATCAGTATGATGGGTCTATAGTCGTCATTCAGAACCCAGCCCGGCAGACCCTC
TTTTTCAATGGCACCCGAGCCCTGAAGGACGAACGATTCCAGCTGGAGGAGTTCTCCCCGCGCC
GAGTGCGCATCAGGCTCTCAGACGCCCGCCTGGAGGACGAGGGGGGCTACTTCTGCCAGCTCTA
CACGGAGGACACCCACCACCAGATCGCCACGCTCACTGTCTTAGTGGCTCCGGAGAATCCTGTG
GTGGAGGTCCGAGAGCAAGCAGTGGAGGGCGGCGAGGTGGAACTCAGCTGCCTGGTTCCGCGGT
CGCGCCCCGCAGCGGTCCTGCGCTGGTATCGCGATCGCAAGGAGCTGAAAGGAGTGAGCAGCGG
CCAGGAGAACGGCAAGGTGTGGAGCGTGGCGAGCACTGTGCGGTTCCGCGTGGACCGCAAGGAC
GACGGCGGTATCGTCATCTGTGAAGCGCAGAACCAGGCGCTGCCCTCGGGGCACAGCAAGCAGA
CGCAGTACGTGCTGGATGTGCAGTATTCCCCCACAGCTCGGATCCACGCCTCTCAAGCTGTAGT
CAGGGAGGGAGACACTCTGGTGCTGACATGTGCTGTCACAGGGAACCCCAGGCCAAACCAGATC
CGCTGGAACCGTGGGAATGAGTCTCTGCCAGAGAGGGCGGAGGCGTTGGGCGAGACGCTCACGC
TGCCTGGCCTGGTATCTGCAGATAACGGCACCTACACCTGCGAGGCGGCGAACAAGCACGGCCA
CGCCAGGGCGCTCTACGTGCTTGTGGTCTATGACCCCGGAGCAGTGGTAGAGGCTCAGACATCG
GTTCCCTACGCCATCGTGGGCGGCATCCTGGCGCTACTGGTGTTTCTGATCATATGCGTGCTAG
TAGGCATGGTGTGGTGCTCTGTCCGACAGAAGGGCTCCTATCTGACCCATGAGGCCAGTGGCTT
GGATGAGCAGGGAGAAGCCAGAGAAGCCTTCCTCAACGGCAGTGATGGACACAAGCGGAAAGAA
GAATTCTTCATTTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001040572	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABB85364	(Get FASTA)	NCBI Sequence Viewer
	EDM08091	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026793
	ENSRNOP00000026793.6
GenBank Protein	Q1WIM1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001040572 ⟸ NM_001047107
- Peptide Label:	precursor
- UniProtKB:	Q1WIM1 (UniProtKB/Swiss-Prot), A6J8Z3 (UniProtKB/TrEMBL), F1M7V6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGRARRFQWPLLLLWAAAAGPGTAQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTL FFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPV VEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKD DGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQI RWNRGNESLPERAEALGETLTLPGLVSADNGTYTCEAANKHGHARALYVLVVYDPGAVVEAQTS VPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKE EFFI hide sequence

Ensembl Acc Id:

ENSRNOP00000026793 ⟸ ENSRNOT00000026793

Ensembl Acc Id:

ENSRNOP00000112401 ⟸ ENSRNOT00000156668

Ensembl Acc Id:

ENSRNOP00000106428 ⟸ ENSRNOT00000164932

Protein Domains

Ig-like Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q1WIM1-F1-model_v2	AlphaFold	Q1WIM1	1-388	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304722	AgrOrtholog
BioCyc Gene	G2FUF-60443	BioCyc
Ensembl Genes	ENSRNOG00000024243	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026793	ENTREZGENE
	ENSRNOT00000026793.7	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
InterPro	CD80_C2-set	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_sub2	UniProtKB/Swiss-Prot
	Ig_V-set	UniProtKB/Swiss-Prot
	Neurexin-like	UniProtKB/Swiss-Prot
KEGG Report	rno:365216	UniProtKB/Swiss-Prot
NCBI Gene	365216	ENTREZGENE
PANTHER	IG-LIKE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	PTHR45889:SF3	UniProtKB/Swiss-Prot
Pfam	C2-set_2	UniProtKB/Swiss-Prot
	Ig_3	UniProtKB/Swiss-Prot
	V-set	UniProtKB/Swiss-Prot
PhenoGen	Cadm4	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000024243	RatGTEx
SMART	4.1m	UniProtKB/Swiss-Prot
	IGc2	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0ABK0LN63_RAT	UniProtKB/TrEMBL
	A0ABK0M944_RAT	UniProtKB/TrEMBL
	A6J8Z3	ENTREZGENE, UniProtKB/TrEMBL
	CADM4_RAT	UniProtKB/Swiss-Prot
	F1M7V6	ENTREZGENE, UniProtKB/TrEMBL
	Q1WIM1	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Cadm4	cell adhesion molecule 4	Igsf4c_predicted	immunoglobulin superfamily, member 4C (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Igsf4c_predicted	immunoglobulin superfamily, member 4C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message