Symbol:
Nrg2
Name:
neuregulin 2
RGD ID:
1303302
Description:
Enables epidermal growth factor receptor activity and signaling receptor binding activity. Involved in ERBB signaling pathway and regulation of synapse organization. Is active in GABA-ergic synapse; extracellular space; and glutamatergic synapse. Orthologous to human NRG2 (neuregulin 2); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neural- and thymus-derived activator for ErbB kinases; NTAK; NTAK alpha1; NTAK alpha2a; NTAK_alpha2a; pro-neuregulin-2, membrane-bound isoform; pro-NRG2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NRG2 (neuregulin 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nrg2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nrg2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NRG2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NRG2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nrg2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NRG2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NRG2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nrg2 (neuregulin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NRG2 (neuregulin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nrg2 (neuregulin 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nrg2b (neuregulin 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nrg2a (neuregulin 2a)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
vn
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 27,890,578 - 28,072,538 (-) NCBI GRCr8 mRatBN7.2 18 27,616,542 - 27,798,505 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 27,743,902 - 27,925,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 28,505,789 - 28,687,737 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 27,840,647 - 28,022,647 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 28,835,391 - 29,015,552 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 28,835,417 - 29,015,552 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 28,544,864 - 28,724,922 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 28,650,097 - 28,828,772 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 28,676,749 - 28,855,418 (-) NCBI Celera 18 27,350,962 - 27,529,758 (-) NCBI Celera Cytogenetic Map 18 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nrg2 Rat 1,2-dichloroethane decreases expression ISO Nrg2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NRG2 mRNA CTD PMID:28960355 Nrg2 Rat 17beta-estradiol increases expression ISO NRG2 (Homo sapiens) 6480464 Estradiol results in increased expression of NRG2 mRNA CTD PMID:23373633 Nrg2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NRG2 mRNA CTD PMID:33387578 Nrg2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Nrg2 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of NRG2 mRNA CTD PMID:21346803 Nrg2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Nrg2 (Mus musculus) 6480464 bisphenol S affects the methylation of NRG2 gene CTD PMID:31683443 Nrg2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NRG2 mRNA CTD PMID:24780913 Nrg2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of NRG2 mRNA CTD PMID:28959563 Nrg2 Rat aflatoxin B1 decreases methylation ISO NRG2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NRG2 intron CTD PMID:30157460 Nrg2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NRG2 mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NRG2 mRNA CTD PMID:35163327 Nrg2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NRG2 mRNA CTD PMID:16483693 Nrg2 Rat arsane affects expression ISO NRG2 (Homo sapiens) 6480464 Arsenic affects the expression of NRG2 protein CTD PMID:24675094 Nrg2 Rat arsenic atom affects expression ISO NRG2 (Homo sapiens) 6480464 Arsenic affects the expression of NRG2 protein CTD PMID:24675094 Nrg2 Rat asbestos affects methylation ISO NRG2 (Homo sapiens) 6480464 Asbestos affects the methylation of NRG2 gene CTD PMID:28722770 Nrg2 Rat benzalkonium chloride multiple interactions ISO Nrg2 (Mus musculus) 6480464 [IL6 protein affects the susceptibility to Benzalkonium Compounds] which affects the expression of NRG2 mRNA CTD PMID:30171875 Nrg2 Rat benzo[a]pyrene increases methylation ISO NRG2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NRG2 promoter CTD PMID:27901495 Nrg2 Rat benzo[a]pyrene affects methylation ISO NRG2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NRG2 intron CTD PMID:30157460 Nrg2 Rat benzo[a]pyrene decreases methylation ISO NRG2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NRG2 3' UTR CTD PMID:27901495 Nrg2 Rat benzo[e]pyrene increases methylation ISO NRG2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of NRG2 intron CTD PMID:30157460 Nrg2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO NRG2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of NRG2 mRNA CTD PMID:31163220 Nrg2 Rat bis(2-ethylhexyl) phthalate increases methylation ISO Nrg2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of NRG2 intron CTD PMID:32864567 Nrg2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NRG2 mRNA CTD PMID:25181051 Nrg2 Rat bisphenol A increases expression ISO Nrg2 (Mus musculus) 6480464 bisphenol A results in increased expression of NRG2 mRNA CTD PMID:32156529 Nrg2 Rat bisphenol A affects methylation ISO NRG2 (Homo sapiens) 6480464 bisphenol A affects the methylation of NRG2 gene CTD PMID:31601247 Nrg2 Rat bisphenol A multiple interactions ISO NRG2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NRG2 gene CTD PMID:31601247 Nrg2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NRG2 gene CTD PMID:28505145 Nrg2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of NRG2 mRNA CTD PMID:19167457 Nrg2 Rat calcitriol decreases expression ISO NRG2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of NRG2 mRNA CTD PMID:16002434 Nrg2 Rat carbon nanotube decreases expression ISO Nrg2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nrg2 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of NRG2 mRNA CTD PMID:26033743 Nrg2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NRG2 mRNA CTD PMID:30556269 Nrg2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of NRG2 mRNA CTD PMID:26033743 Nrg2 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of NRG2 mRNA CTD PMID:26033743 Nrg2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NRG2 mRNA CTD PMID:30556269 Nrg2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of NRG2 mRNA CTD PMID:26033743 Nrg2 Rat cyclosporin A decreases expression ISO NRG2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NRG2 mRNA CTD PMID:20106945 Nrg2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of NRG2 mRNA CTD PMID:23914054 Nrg2 Rat dorsomorphin multiple interactions ISO NRG2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nrg2 Rat epoxiconazole increases expression ISO Nrg2 (Mus musculus) 6480464 epoxiconazole results in increased expression of NRG2 mRNA CTD PMID:35436446 Nrg2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of NRG2 mRNA CTD PMID:30307764 Nrg2 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of NRG2 mRNA CTD PMID:31881178 Nrg2 Rat fonofos increases methylation ISO NRG2 (Homo sapiens) 6480464 Fonofos results in increased methylation of NRG2 promoter CTD PMID:22847954 Nrg2 Rat fulvestrant multiple interactions ISO NRG2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NRG2 gene CTD PMID:31601247 Nrg2 Rat fulvestrant increases methylation ISO NRG2 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of NRG2 gene CTD PMID:31601247 Nrg2 Rat lipopolysaccharide multiple interactions ISO NRG2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of NRG2 mRNA] CTD PMID:35811015 Nrg2 Rat lipopolysaccharide increases expression ISO NRG2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of NRG2 mRNA CTD PMID:35811015 Nrg2 Rat manganese atom increases expression ISO NRG2 (Homo sapiens) 6480464 Manganese results in increased expression of NRG2 mRNA CTD PMID:17175027 Nrg2 Rat manganese(0) increases expression ISO NRG2 (Homo sapiens) 6480464 Manganese results in increased expression of NRG2 mRNA CTD PMID:17175027 Nrg2 Rat manganese(II) chloride increases expression ISO NRG2 (Homo sapiens) 6480464 manganese chloride results in increased expression of NRG2 mRNA CTD PMID:17175027 Nrg2 Rat melphalan decreases expression ISO NRG2 (Homo sapiens) 6480464 Melphalan results in decreased expression of NRG2 mRNA CTD PMID:22363485 Nrg2 Rat methylmercury chloride decreases expression ISO NRG2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NRG2 mRNA CTD PMID:28001369 Nrg2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of NRG2 gene CTD PMID:33148267 Nrg2 Rat nickel atom decreases expression ISO NRG2 (Homo sapiens) 6480464 Nickel results in decreased expression of NRG2 mRNA CTD PMID:24768652 and PMID:25583101 Nrg2 Rat ozone multiple interactions ISO Nrg2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of NRG2 mRNA CTD PMID:34911549 Nrg2 Rat paracetamol decreases expression ISO NRG2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NRG2 mRNA CTD PMID:22230336 and PMID:29067470 Nrg2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NRG2 mRNA CTD PMID:33387578 Nrg2 Rat parathion increases methylation ISO NRG2 (Homo sapiens) 6480464 Parathion results in increased methylation of NRG2 promoter CTD PMID:22847954 Nrg2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of NRG2 mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NRG2 mRNA CTD PMID:35163327 Nrg2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of NRG2 gene CTD PMID:33148267 Nrg2 Rat pirinixic acid multiple interactions ISO Nrg2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of NRG2 mRNA CTD PMID:19710929 Nrg2 Rat potassium dichromate decreases expression ISO Nrg2 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of NRG2 mRNA CTD PMID:23608068 Nrg2 Rat raloxifene increases expression ISO NRG2 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of NRG2 mRNA CTD PMID:15849065 Nrg2 Rat resveratrol multiple interactions ISO NRG2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of NRG2 mRNA CTD PMID:23557933 Nrg2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NRG2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of NRG2 mRNA] CTD PMID:35811015 Nrg2 Rat SB 431542 multiple interactions ISO NRG2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nrg2 Rat silicon dioxide increases expression ISO NRG2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of NRG2 mRNA CTD PMID:34973136 Nrg2 Rat sodium arsenite decreases expression ISO NRG2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NRG2 mRNA CTD PMID:34032870 Nrg2 Rat sodium arsenite increases expression ISO Nrg2 (Mus musculus) 6480464 sodium arsenite results in increased expression of NRG2 mRNA CTD PMID:37682722 Nrg2 Rat terbufos increases methylation ISO NRG2 (Homo sapiens) 6480464 terbufos results in increased methylation of NRG2 promoter CTD PMID:22847954 Nrg2 Rat titanium dioxide increases methylation ISO Nrg2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NRG2 gene CTD PMID:35295148 Nrg2 Rat titanium dioxide decreases methylation ISO Nrg2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NRG2 gene and titanium dioxide results in decreased methylation of NRG2 promoter CTD PMID:35295148 Nrg2 Rat titanium dioxide increases expression ISO Nrg2 (Mus musculus) 6480464 titanium dioxide results in increased expression of NRG2 mRNA CTD PMID:35295148 Nrg2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NRG2 mRNA CTD PMID:33387578 Nrg2 Rat triclosan decreases expression ISO NRG2 (Homo sapiens) 6480464 Triclosan results in decreased expression of NRG2 mRNA CTD PMID:30510588 Nrg2 Rat triptonide decreases expression ISO Nrg2 (Mus musculus) 6480464 triptonide results in decreased expression of NRG2 mRNA CTD PMID:33045310 Nrg2 Rat valproic acid affects expression ISO NRG2 (Homo sapiens) 6480464 Valproic Acid affects the expression of NRG2 mRNA CTD PMID:25979313 Nrg2 Rat valproic acid decreases expression ISO NRG2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NRG2 mRNA CTD PMID:26272509 Nrg2 Rat valproic acid multiple interactions ISO NRG2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NRG2 mRNA CTD PMID:27188386 Nrg2 Rat vorinostat increases expression ISO NRG2 (Homo sapiens) 6480464 vorinostat results in increased expression of NRG2 mRNA CTD PMID:26272509 Nrg2 Rat vorinostat multiple interactions ISO NRG2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NRG2 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-trinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) asbestos (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) calcitriol (ISO) carbon nanotube (ISO) copper atom (EXP) copper(0) (EXP) cyclosporin A (ISO) decabromodiphenyl ether (EXP) dorsomorphin (ISO) epoxiconazole (ISO) fenvalerate (EXP) fipronil (EXP) fonofos (ISO) fulvestrant (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melphalan (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) nickel atom (ISO) ozone (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) pirinixic acid (ISO) potassium dichromate (ISO) raloxifene (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) terbufos (ISO) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) triptonide (ISO) valproic acid (ISO) vorinostat (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.
Higashiyama S, etal., J Biochem (Tokyo) 1997 Sep;122(3):675-80.
3.
Neuregulin isoforms exhibit distinct patterns of ErbB family receptor activation.
Hobbs SS, etal., Oncogene. 2002 Dec 5;21(55):8442-52. doi: 10.1038/sj.onc.1205960.
4.
Bidirectional Signaling of Neuregulin-2 Mediates Formation of GABAergic Synapses and Maturation of Glutamatergic Synapses in Newborn Granule Cells of Postnatal Hippocampus.
Lee KH, etal., J Neurosci. 2015 Dec 16;35(50):16479-93. doi: 10.1523/JNEUROSCI.1585-15.2015.
5.
Neuregulin-2 is developmentally regulated and targeted to dendrites of central neurons.
Longart M, etal., J Comp Neurol 2004 Apr 26;472(2):156-72.
6.
ErbB4 reduces synaptic GABAA currents independent of its receptor tyrosine kinase activity.
Mitchell RM, etal., Proc Natl Acad Sci U S A. 2013 Nov 26;110(48):19603-8. doi: 10.1073/pnas.1312791110. Epub 2013 Nov 11.
7.
Neuregulins and cancer.
Montero JC, etal., Clin Cancer Res. 2008 Jun 1;14(11):3237-41. doi: 10.1158/1078-0432.CCR-07-5133.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Nrg2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 27,890,578 - 28,072,538 (-) NCBI GRCr8 mRatBN7.2 18 27,616,542 - 27,798,505 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 27,743,902 - 27,925,871 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 28,505,789 - 28,687,737 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 27,840,647 - 28,022,647 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 28,835,391 - 29,015,552 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 28,835,417 - 29,015,552 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 28,544,864 - 28,724,922 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 28,650,097 - 28,828,772 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 28,676,749 - 28,855,418 (-) NCBI Celera 18 27,350,962 - 27,529,758 (-) NCBI Celera Cytogenetic Map 18 p11 NCBI
NRG2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 139,846,781 - 140,043,299 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 139,846,779 - 140,043,299 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 139,226,366 - 139,422,884 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 139,207,444 - 139,403,063 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 135,301,792 - 135,498,704 (-) NCBI Celera Cytogenetic Map 5 q31.2 NCBI HuRef 5 134,369,651 - 134,566,061 (-) NCBI HuRef CHM1_1 5 138,659,474 - 138,855,994 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 140,371,883 - 140,568,402 (-) NCBI T2T-CHM13v2.0
Nrg2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 36,147,634 - 36,332,754 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 36,150,705 - 36,330,433 (-) Ensembl GRCm39 Ensembl GRCm38 18 36,014,581 - 36,197,532 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 36,017,652 - 36,197,380 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 36,177,303 - 36,356,814 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 36,177,303 - 36,356,814 (-) NCBI MGSCv36 mm8 Celera 18 36,474,450 - 36,653,084 (-) NCBI Celera Cytogenetic Map 18 B2 NCBI cM Map 18 19.38 NCBI
Nrg2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955418 548,624 - 793,861 (+) NCBI ChiLan1.0 ChiLan1.0
NRG2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 135,109,036 - 135,304,138 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 133,248,589 - 133,444,133 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 135,212,496 - 135,411,469 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 141,333,911 - 141,528,420 (-) NCBI panpan1.1 PanPan1.1 panPan2
NRG2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 35,085,192 - 35,264,509 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 35,085,361 - 35,264,378 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 32,188,379 - 32,434,387 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 35,540,482 - 35,786,931 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 35,540,758 - 35,596,619 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 32,592,831 - 32,839,160 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 33,459,495 - 33,706,597 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 34,211,046 - 34,457,510 (-) NCBI UU_Cfam_GSD_1.0
Nrg2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 152,546,964 - 152,728,032 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936531 8,884,642 - 9,064,869 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936531 8,884,565 - 9,064,541 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NRG2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 141,662,369 - 141,824,727 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 141,660,936 - 141,825,281 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 147,549,110 - 147,575,155 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NRG2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 42,498,367 - 42,694,330 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 42,499,503 - 42,692,968 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 35,126,483 - 35,386,932 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nrg2
.
Predicted Target Of
Count of predictions: 178 Count of miRNA genes: 73 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000025890, ENSRNOT00000025902, ENSRNOT00000028713, ENSRNOT00000033501, ENSRNOT00000049222, ENSRNOT00000068321 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331735 Rf44 Renal function QTL 44 2.981 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 18 18234564 31359530 Rat 61382 Bp46 Blood pressure QTL 46 18.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11941791 31393320 Rat 2301413 Bp318 Blood pressure QTL 318 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 26548082 46969551 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 61388 Bp2 Blood pressure QTL 2 3.23 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 1 35374722 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 12904668 Bw188 Body weight QTL 188 0.03 body mass (VT:0001259) body weight (CMO:0000012) 18 26548082 46969551 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 12904669 Cm125 Cardiac mass QTL 125 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 26548082 46969551 Rat 1641923 Colcr8 Colorectal carcinoma resistance QTL 8 3.1 0.0014 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 18 22066242 52293055 Rat 12904670 Cm126 Cardiac mass QTL 126 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 26548082 46969551 Rat 2312568 Glom21 Glomerulus QTL 21 2 0.005 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 18 5185858 40503530 Rat 12904677 Kidm72 Kidney mass QTL 72 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 26548082 46969551 Rat 1331766 Bp236 Blood pressure QTL 236 3.022 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 11944299 31359530 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 12904673 Cm127 Cardiac mass QTL 127 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 26548082 46969551 Rat 12904675 Am19 Aortic mass QTL 19 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 26548082 46969551 Rat 631264 Scl22 Serum cholesterol level QTL 22 6.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 18 11941791 31393320 Rat 1331775 Bp235 Blood pressure QTL 235 3.201 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 18234564 31359530 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2312598 Bp340 Blood pressure QTL 340 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 1 30558703 Rat 2300180 Bmd67 Bone mineral density QTL 67 4.8 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 18 1 34291613 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331753 Bp231 Blood pressure QTL 231 3.643 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944299 52293055 Rat 2293661 Bss50 Bone structure and strength QTL 50 4.64 0.0003 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 18 1 34291613 Rat 61375 Bp41 Blood pressure QTL 41 2.4 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 18 11944299 41122201 Rat
D18Rat36
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 27,680,421 - 27,680,742 (+) MAPPER mRatBN7.2 Rnor_6.0 18 28,897,279 - 28,897,599 NCBI Rnor6.0 Rnor_5.0 18 28,606,752 - 28,607,072 UniSTS Rnor5.0 RGSC_v3.4 18 28,710,853 - 28,711,210 RGD RGSC3.4 RGSC_v3.4 18 28,710,885 - 28,711,205 UniSTS RGSC3.4 RGSC_v3.1 18 28,737,531 - 28,737,851 RGD Celera 18 27,411,606 - 27,411,926 UniSTS RH 3.4 Map 18 387.3 RGD RH 3.4 Map 18 387.3 UniSTS RH 2.0 Map 18 524.9 RGD FHH x ACI Map 18 18.27 RGD Cytogenetic Map 18 p11 UniSTS
D18Wox22
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 27,798,055 - 27,798,289 (+) MAPPER mRatBN7.2 Rnor_6.0 18 29,015,103 - 29,015,336 NCBI Rnor6.0 Rnor_5.0 18 28,724,473 - 28,724,706 UniSTS Rnor5.0 RGSC_v3.4 18 28,828,323 - 28,828,556 UniSTS RGSC3.4 Celera 18 27,529,309 - 27,529,542 UniSTS Cytogenetic Map 18 p11 UniSTS
UniSTS:492223
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 27,770,460 - 27,770,726 (+) MAPPER mRatBN7.2 Rnor_6.0 18 28,987,377 - 28,987,642 NCBI Rnor6.0 Rnor_5.0 18 28,696,747 - 28,697,012 UniSTS Rnor5.0 RGSC_v3.4 18 28,801,073 - 28,801,338 UniSTS RGSC3.4 Celera 18 27,501,630 - 27,501,895 UniSTS Cytogenetic Map 18 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
23
113
87
86
55
25
55
6
188
71
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025902 ⟹ ENSRNOP00000025901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 27,619,661 - 27,669,553 (-) Ensembl Rnor_6.0 Ensembl 18 28,835,653 - 28,871,849 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000028713 ⟹ ENSRNOP00000028713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl Rnor_6.0 Ensembl 18 28,835,417 - 29,015,552 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097771 ⟹ ENSRNOP00000093404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098732 ⟹ ENSRNOP00000093112
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119243 ⟹ ENSRNOP00000087759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 27,619,661 - 27,798,505 (-) Ensembl
RefSeq Acc Id:
NM_001136151 ⟹ NP_001129623
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,890,578 - 28,072,538 (-) NCBI mRatBN7.2 18 27,616,542 - 27,798,505 (-) NCBI Rnor_6.0 18 28,835,391 - 29,015,552 (-) NCBI Rnor_5.0 18 28,544,864 - 28,724,922 (-) NCBI RGSC_v3.4 18 28,650,097 - 28,828,772 (-) RGD Celera 18 27,350,962 - 27,529,758 (-) RGD
Sequence:
GAATTCGGCACGAGTCCTGGCGCACAGGGAGGGAGCGCTGCGCTGCGCCGGGGCTGCGCATCGCGGCCCACTTGCCGCTTGTCCCCTGCCCTGGCTGGGCCACCTCCCCGGGCTGCCGGTGGAGGGCT
hide sequence
RefSeq Acc Id:
XM_063277501 ⟹ XP_063133571
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 28,072,318 (-) NCBI
RefSeq Acc Id:
XM_063277502 ⟹ XP_063133572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 28,072,318 (-) NCBI
RefSeq Acc Id:
XM_063277503 ⟹ XP_063133573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 27,943,654 (-) NCBI
RefSeq Acc Id:
XM_063277504 ⟹ XP_063133574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 27,943,651 (-) NCBI
RefSeq Acc Id:
XM_063277505 ⟹ XP_063133575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 27,914,547 (-) NCBI
RefSeq Acc Id:
XM_063277506 ⟹ XP_063133576
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,892,745 - 27,914,547 (-) NCBI
RefSeq Acc Id:
XM_063277507 ⟹ XP_063133577
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,900,523 - 28,072,318 (-) NCBI
RefSeq Acc Id:
XM_063277508 ⟹ XP_063133578
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 27,900,523 - 28,072,318 (-) NCBI
RefSeq Acc Id:
NP_001129623 ⟸ NM_001136151
- UniProtKB:
D4A078 (UniProtKB/TrEMBL), A0A8I6GKI5 (UniProtKB/TrEMBL)
- Sequence:
MRQVCCSALPPPLEKARCSSYSYSDSSSSSSSNNSSSSTSSRSSSRSSSRSSRGSTTTTSSSENSGSNSGSIFRPAAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGSSMLLFGVSLAC
hide sequence
Ensembl Acc Id:
ENSRNOP00000028713 ⟸ ENSRNOT00000028713
Ensembl Acc Id:
ENSRNOP00000025901 ⟸ ENSRNOT00000025902
Ensembl Acc Id:
ENSRNOP00000093112 ⟸ ENSRNOT00000098732
Ensembl Acc Id:
ENSRNOP00000093404 ⟸ ENSRNOT00000097771
Ensembl Acc Id:
ENSRNOP00000087759 ⟸ ENSRNOT00000119243
RefSeq Acc Id:
XP_063133572 ⟸ XM_063277502
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A510 (UniProtKB/TrEMBL), A0A8I6GKI5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133571 ⟸ XM_063277501
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AHJ7 (UniProtKB/TrEMBL), A0A8I6GKI5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133573 ⟸ XM_063277503
- Peptide Label:
isoform X3
- UniProtKB:
A6J302 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133574 ⟸ XM_063277504
- Peptide Label:
isoform X4
- UniProtKB:
F1LM11 (UniProtKB/TrEMBL), A6J302 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133576 ⟸ XM_063277506
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063133575 ⟸ XM_063277505
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063133577 ⟸ XM_063277507
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_063133578 ⟸ XM_063277508
- Peptide Label:
isoform X8
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-14
Nrg2
neuregulin 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains Ig-like, EGF-like and hydrophobic domains similar to other neuregulins; member of EGF family
1304015
gene_expression
expressed in adult brain and thymus; expressed only in brain of E11.5 embryos
1304015
gene_physical_interaction
binds to ErbB3 and ErbB4 but not ErbB1 or ErbB2
1304015
gene_transcript
expressed as five alternatively spliced isoforms in PC-12 cells
1304015
