Nrg2 (neuregulin 2) - Rat Genome Database

Name: Nrg2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Nrg2 (neuregulin 2) Rattus norvegicus

Analyze

Symbol:

Nrg2

Name:

neuregulin 2

RGD ID:

1303302

Description:

Enables epidermal growth factor receptor activity and signaling receptor binding activity. Involved in ERBB signaling pathway and regulation of synapse organization. Is active in GABA-ergic synapse; extracellular space; and glutamatergic synapse. Orthologous to human NRG2 (neuregulin 2); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

neural- and thymus-derived activator for ErbB kinases; NTAK; NTAK alpha1; NTAK alpha2a; NTAK_alpha2a; pro-neuregulin-2, membrane-bound isoform; pro-NRG2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NRG2 (neuregulin 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nrg2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nrg2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NRG2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NRG2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nrg2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NRG2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NRG2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nrg2 (neuregulin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NRG2 (neuregulin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nrg2 (neuregulin 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nrg2b (neuregulin 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nrg2a (neuregulin 2a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vn	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,890,578 - 28,072,538 (-)	NCBI		GRCr8
mRatBN7.2	18	27,616,542 - 27,798,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,743,902 - 27,925,871 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,505,789 - 28,687,737 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,840,647 - 28,022,647 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,835,391 - 29,015,552 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,835,417 - 29,015,552 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,544,864 - 28,724,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,650,097 - 28,828,772 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	28,676,749 - 28,855,418 (-)	NCBI
Celera	18	27,350,962 - 27,529,758 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autosomal dominant intellectual developmental disorder 31 (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

asbestos (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dorsomorphin (ISO)

epoxiconazole (ISO)

fenvalerate (EXP)

fipronil (EXP)

fonofos (ISO)

fulvestrant (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

melphalan (ISO)

methylmercury chloride (ISO)

N,N-diethyl-m-toluamide (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

parathion (ISO)

permethrin (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

raloxifene (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

terbufos (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IBA,IEA)

cell surface receptor signaling pathway (ISO)

epidermal growth factor receptor signaling pathway (IDA)

ERBB2-ERBB3 signaling pathway (ISO)

ERBB4 signaling pathway (IDA,ISO)

ERBB4-ERBB4 signaling pathway (ISO)

intracellular signal transduction (IBA,IEA)

nervous system development (IEA)

regulation of synapse assembly (IDA,IMP)

regulation of synapse maturation (IDA,IMP)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IDA,IEA,ISO)

GABA-ergic synapse (IDA,IMP)

glutamatergic synapse (IDA,IMP)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

epidermal growth factor receptor activity (IDA)

epidermal growth factor receptor binding (IDA)

ErbB-3 class receptor binding (IDA)

ErbB-4 class receptor binding (IDA)

growth factor activity (IEA)

receptor ligand activity (IDA,ISO)

signaling receptor binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

epidermal growth factor/neuregulin signaling pathway (IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.	Higashiyama S, etal., J Biochem (Tokyo) 1997 Sep;122(3):675-80.
3.	Neuregulin isoforms exhibit distinct patterns of ErbB family receptor activation.	Hobbs SS, etal., Oncogene. 2002 Dec 5;21(55):8442-52. doi: 10.1038/sj.onc.1205960.
4.	Bidirectional Signaling of Neuregulin-2 Mediates Formation of GABAergic Synapses and Maturation of Glutamatergic Synapses in Newborn Granule Cells of Postnatal Hippocampus.	Lee KH, etal., J Neurosci. 2015 Dec 16;35(50):16479-93. doi: 10.1523/JNEUROSCI.1585-15.2015.
5.	Neuregulin-2 is developmentally regulated and targeted to dendrites of central neurons.	Longart M, etal., J Comp Neurol 2004 Apr 26;472(2):156-72.
6.	ErbB4 reduces synaptic GABAA currents independent of its receptor tyrosine kinase activity.	Mitchell RM, etal., Proc Natl Acad Sci U S A. 2013 Nov 26;110(48):19603-8. doi: 10.1073/pnas.1312791110. Epub 2013 Nov 11.
7.	Neuregulins and cancer.	Montero JC, etal., Clin Cancer Res. 2008 Jun 1;14(11):3237-41. doi: 10.1158/1078-0432.CCR-07-5133.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9168114	PMID:9742126	PMID:16944454	PMID:26027736	PMID:27113200	PMID:31240601

Genomics

Comparative Map Data

Nrg2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,890,578 - 28,072,538 (-)	NCBI		GRCr8
mRatBN7.2	18	27,616,542 - 27,798,505 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	27,743,902 - 27,925,871 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,505,789 - 28,687,737 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,840,647 - 28,022,647 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,835,391 - 29,015,552 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,835,417 - 29,015,552 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	28,544,864 - 28,724,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	28,650,097 - 28,828,772 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	28,676,749 - 28,855,418 (-)	NCBI
Celera	18	27,350,962 - 27,529,758 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

NRG2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	139,846,781 - 140,043,299 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	139,846,779 - 140,043,299 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	139,226,366 - 139,422,884 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	139,207,444 - 139,403,063 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	135,301,792 - 135,498,704 (-)	NCBI		Celera
Cytogenetic Map	5	q31.2	NCBI
HuRef	5	134,369,651 - 134,566,061 (-)	NCBI		HuRef
CHM1_1	5	138,659,474 - 138,855,994 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	140,371,883 - 140,568,402 (-)	NCBI		T2T-CHM13v2.0

Nrg2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	36,147,634 - 36,332,754 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	36,150,705 - 36,330,433 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	36,014,581 - 36,197,532 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	36,017,652 - 36,197,380 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	36,177,303 - 36,356,814 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	36,177,303 - 36,356,814 (-)	NCBI		MGSCv36	mm8
Celera	18	36,474,450 - 36,653,084 (-)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.38	NCBI

Nrg2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955418	548,624 - 793,861 (+)	NCBI	ChiLan1.0	ChiLan1.0

NRG2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	135,109,036 - 135,304,138 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	133,248,589 - 133,444,133 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	135,212,496 - 135,411,469 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	141,333,911 - 141,528,420 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

NRG2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	35,085,192 - 35,264,509 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	35,085,361 - 35,264,378 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	32,188,379 - 32,434,387 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	35,540,482 - 35,786,931 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	35,540,758 - 35,596,619 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	32,592,831 - 32,839,160 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	33,459,495 - 33,706,597 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	34,211,046 - 34,457,510 (-)	NCBI		UU_Cfam_GSD_1.0

Nrg2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	152,546,964 - 152,728,032 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	8,884,642 - 9,064,869 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	8,884,565 - 9,064,541 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NRG2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	141,662,369 - 141,824,727 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	141,660,936 - 141,825,281 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	147,549,110 - 147,575,155 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NRG2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	42,498,367 - 42,694,330 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	42,499,503 - 42,692,968 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	35,126,483 - 35,386,932 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nrg2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	32,620,295 - 32,810,391 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	32,620,025 - 32,810,990 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nrg2
739 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	178
Count of miRNA genes:	73
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000025890, ENSRNOT00000025902, ENSRNOT00000028713, ENSRNOT00000033501, ENSRNOT00000049222, ENSRNOT00000068321
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat

Markers in Region

D18Rat36

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,680,421 - 27,680,742 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,897,279 - 28,897,599	NCBI	Rnor6.0
Rnor_5.0	18	28,606,752 - 28,607,072	UniSTS	Rnor5.0
RGSC_v3.4	18	28,710,853 - 28,711,210	RGD	RGSC3.4
RGSC_v3.4	18	28,710,885 - 28,711,205	UniSTS	RGSC3.4
RGSC_v3.1	18	28,737,531 - 28,737,851	RGD
Celera	18	27,411,606 - 27,411,926	UniSTS
RH 3.4 Map	18	387.3	RGD
RH 3.4 Map	18	387.3	UniSTS
RH 2.0 Map	18	524.9	RGD
FHH x ACI Map	18	18.27	RGD
Cytogenetic Map	18	p11	UniSTS

D18Wox22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,798,055 - 27,798,289 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	29,015,103 - 29,015,336	NCBI	Rnor6.0
Rnor_5.0	18	28,724,473 - 28,724,706	UniSTS	Rnor5.0
RGSC_v3.4	18	28,828,323 - 28,828,556	UniSTS	RGSC3.4
Celera	18	27,529,309 - 27,529,542	UniSTS
Cytogenetic Map	18	p11	UniSTS

UniSTS:492223

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,770,460 - 27,770,726 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,987,377 - 28,987,642	NCBI	Rnor6.0
Rnor_5.0	18	28,696,747 - 28,697,012	UniSTS	Rnor5.0
RGSC_v3.4	18	28,801,073 - 28,801,338	UniSTS	RGSC3.4
Celera	18	27,501,630 - 27,501,895	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									4
Low			17	6	19	6			60	3	33	11
Below cutoff	3	18	36	31		31	8	11	10	32	8		8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001136151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB001576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D89995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D89996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000025902 ⟹ ENSRNOP00000025901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,619,661 - 27,669,553 (-)	Ensembl
Rnor_6.0 Ensembl	18	28,835,653 - 28,871,849 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000028713 ⟹ ENSRNOP00000028713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl
Rnor_6.0 Ensembl	18	28,835,417 - 29,015,552 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097771 ⟹ ENSRNOP00000093404

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098732 ⟹ ENSRNOP00000093112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119243 ⟹ ENSRNOP00000087759

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	27,619,661 - 27,798,505 (-)	Ensembl

RefSeq Acc Id:

NM_001136151 ⟹ NP_001129623

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,890,578 - 28,072,538 (-)	NCBI
mRatBN7.2	18	27,616,542 - 27,798,505 (-)	NCBI
Rnor_6.0	18	28,835,391 - 29,015,552 (-)	NCBI
Rnor_5.0	18	28,544,864 - 28,724,922 (-)	NCBI
RGSC_v3.4	18	28,650,097 - 28,828,772 (-)	RGD
Celera	18	27,350,962 - 27,529,758 (-)	RGD

Sequence:

show sequence

GAATTCGGCACGAGTCCTGGCGCACAGGGAGGGAGCGCTGCGCTGCGCCGGGGCTGCGCATCGC
GGCCCACTTGCCGCTTGTCCCCTGCCCTGGCTGGGCCACCTCCCCGGGCTGCCGGTGGAGGGCT
TCGAGGCGCTAACGTTACGCTGTTTCCGGTTTTCCAGAGGGCTCTGTTTCCCCTCCCAAGGCGG
CGGCGGCTGAGCGGCGGAGCCCCCCAAATGGCCTGGCCAGATGCGGCAGGTTTGCTGCTCAGCG
CTGCCGCCGCCACTGGAGAAGGCTCGGTGCAGCAGCTACAGCTACAGCGACAGCAGCAGCAGCA
GCAGCAGCAACAACAGCAGCAGCAGCACCAGCAGCAGAAGCAGCAGCAGAAGCAGCAGCAGAAG
CAGCAGAGGCAGCACCACCACCACCAGCAGCAGCGAGAACAGCGGCAGCAACAGCGGCAGCATC
TTCCGTCCCGCTGCGCCCCCAGAGCCGCGGCCGCAGCCACAGCCGCAGCCCCGCAGCCCCGCAG
CCCGGAGAGCCGCCGCCCGCTCGCGAGCCGCAGCCGCCGGCGGCATGAGGCGCGACCCGGCCCC
CGGCTCCTCGATGCTGCTCTTCGGTGTGTCACTCGCCTGCTACTCGCCCAGCCTCAAGTCCGTG
CAGGACCAGGCGTACAAGGCACCCGTGGTGGTGGAGGGCAAGGTACAGGGACTGGCCCCGGCAG
GCGGTTCCAGCTCTAACAGCACCCGAGAGCCTCCCGCCTCGGGTCGGGTGGCGCTGGTGAAGGT
GCTGGACAAGTGGCCGCTCCGGAGCGGGGGGCTGCAGCGCGAGCAGGTGATCAGCGTGGGCTCC
TGCGCGCCGCTCGAAAGGAACCAGCGCTACATCTTTTTCCTGGAGCCCACCGAGCAGCCCTTAG
TTTTTAAGACAGCCTTTGCCCCGGTCGACCCTAACGGCAAAAACATCAAGAAAGAGGTGGGCAA
GATCCTGTGCACTGACTGCGCAACCCGGCCCAAGCTGAAGAAGATGAAGAGTCAGACAGGAGAG
GTGGGCGAGAAGCAGTCGCTCAAGTGTGAGGCGGCGGCGGGGAACCCCCAGCCCTCCTATCGAT
GGTTCAAGGACGGCAAGGAGCTCAACCGGAGTCGTGACATTCGCATCAAGTATGGCAACGGCAG
AAAGAACTCACGGCTACAGTTCAACAAAGTGAAGGTGGAGGACGCTGGAGAGTACGTCTGTGAG
GCTGAGAACATCCTTGGGAAGGACACTGTGAGGGGCCGGCTCCATGTCAACAGTGTGAGCACCA
CTCTGTCGTCCTGGTCGGGGCACGCCCGGAAGTGCAATGAGACAGCCAAGTCCTACTGTGTGAA
TGGAGGCGTGTGCTACTACATCGAAGGCATCAACCAACTCTCCTGCAAATGTCCAAACGGATTC
TTCGGACAGAGATGTTTGGAGAAACTGCCTTTGCGATTGTACATGCCAGATCCTAAGCAAAAGG
CTGAGGAGCTGTACCAGAAGAGAGTCCTGACAATTACCGGCATCTGTGTGGCTCTGCTGGTCGT
GGGCATCGTCTGTGTGGTCGCCTACTGCAAGACTAAAAAACAGAGGAGGCAAATGCATCACCAT
CTCCGGCAGAACATGTGTCCGGCCCACCAGAACCGAAGCCTGGCCAATGGGCCCAGCCACCCTC
GGCTGGACCCTGAGGAGATCCAGATGGCAGATTACATTTCCAAAAATGTGCCAGCTACAGACCA
TGTGATCCGGAGGGAAGCTGAGACCACATTTTCTGGGAGCCACTCCTGTTCACCCTCTCACCAC
TGTTCCACAGCCACACCCACCTCCAGCCACAGACATGAGAGCCACACGTGGAGCTTGGAACGTT
CGGAGAGCCTGACCTCGGATTCCCAGTCAGGCATCATGCTATCATCAGTGGGCACCAGCAAGTG
CAACAGCCCAGCATGTGTGGAGGCACGGGCACGGAGGGCAGCAGCCTACAGCCAGGAGGAGCGA
CGCAGGGCTGCCATGCCACCCTACCACGACTCCATAGACTCGCTGCGTGACTCCCCACACAGTG
AGAGGTACGTGTCAGCCCTGACCACGCCCGCGCGCCTTTCGCCCGTGGACTTCCACTACTCGCT
GGCCACCCAGGTGCCGACTTTCGAGATCACGTCGCCCAACTCTGCCCACGCCGTGTCGCTGCCA
CCCGCAGCGCCCATCAGCTACCGCCTAGCGGAGCAGCAGCCGCTCCTGCGGCACCCAGCGCCGC
CCGGCCCGGGGCCAGGGCCCGGAGCGGACATGCAGCGCAGCTACGACAGCTACTACTACCCGGC
GGCGGGGCCCGGGCCGCGGCGCGGCGCCTGCGCGCTGGGAGGCAGTTTGGGCAGCCTGCCCGCC
AGCCCCTTCCGCATCCCGGAGGACGACGAGTACGAGACCACGCAGGAGTGCGCGCCCCCGCCAC
CGCCGCGGCCGCGCACGCGCGGCGCGTCCCGCAGGACGTCGGCGGGGCCGCGGCGCTGGCGGCG
CTCCCGCCTCAACGGGTTGGCTGCGCAGCGCGCACGCGCAGCGCGGGACTCGCTGTCGTTGAGC
AGCGGTTCGGGCTGCGGCTCGGCGTCGGCCTCGGACGACGATGCGGACGACGCGGACGGGGCGC
TGGCGGCCGAGAGCACGCCTTTCCTCGGCCTGCGAGCGGCGCACGACGCGCTGCGCTCGGACTC
GCCGCCGCTCTGCCCGGCGGCGGACAGCAGGACTTACTACTCCCTGGACAGCCACAGCACGCGC
GCCAGCAGCAGACACAGCCGGGGGCCGCCCACGAGGGCAAAGCAGGACTCCGGGCCCCTCTAAG
GCCTCCCGCCTCGCCCGCCTCACGTCTCCGAGGAGAGCGGAGACCACCGACTGGAGAGGGAAAA
AGGAGCGAACAAAGAAATAAAAATATTTTTATTTTCTATAAAAGGAAAAAAGTATAACAAAATG
TTTTATTTTCATTTTAGCAAAAAAAATTGTCTTATAATACTAGCTAACGGCAAAGACGTTTTTA
TAGGGAAACTATTTATATGTAACATCCTGATTTACAGCTTCGGAAAAAAAAAAGAAACAACAAA
AAAAA

hide sequence

RefSeq Acc Id:

XM_063277501 ⟹ XP_063133571

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 28,072,318 (-)	NCBI

RefSeq Acc Id:

XM_063277502 ⟹ XP_063133572

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 28,072,318 (-)	NCBI

RefSeq Acc Id:

XM_063277503 ⟹ XP_063133573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 27,943,654 (-)	NCBI

RefSeq Acc Id:

XM_063277504 ⟹ XP_063133574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 27,943,651 (-)	NCBI

RefSeq Acc Id:

XM_063277505 ⟹ XP_063133575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 27,914,547 (-)	NCBI

RefSeq Acc Id:

XM_063277506 ⟹ XP_063133576

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,892,745 - 27,914,547 (-)	NCBI

RefSeq Acc Id:

XM_063277507 ⟹ XP_063133577

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,900,523 - 28,072,318 (-)	NCBI

RefSeq Acc Id:

XM_063277508 ⟹ XP_063133578

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,900,523 - 28,072,318 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001129623	(Get FASTA)	NCBI Sequence Viewer
	XP_063133571	(Get FASTA)	NCBI Sequence Viewer
	XP_063133572	(Get FASTA)	NCBI Sequence Viewer
	XP_063133573	(Get FASTA)	NCBI Sequence Viewer
	XP_063133574	(Get FASTA)	NCBI Sequence Viewer
	XP_063133575	(Get FASTA)	NCBI Sequence Viewer
	XP_063133576	(Get FASTA)	NCBI Sequence Viewer
	XP_063133577	(Get FASTA)	NCBI Sequence Viewer
	XP_063133578	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA23344	(Get FASTA)	NCBI Sequence Viewer
	BAA23345	(Get FASTA)	NCBI Sequence Viewer
	BAA23348	(Get FASTA)	NCBI Sequence Viewer
	EDL76284	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025901.8
	ENSRNOP00000028713
	ENSRNOP00000028713.7
	ENSRNOP00000087759.1
	ENSRNOP00000093112.1
	ENSRNOP00000093404.1
GenBank Protein	O35569	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001129623 ⟸ NM_001136151

- UniProtKB:

D4A078 (UniProtKB/TrEMBL), A0A8I6GKI5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRQVCCSALPPPLEKARCSSYSYSDSSSSSSSNNSSSSTSSRSSSRSSSRSSRGSTTTTSSSEN
SGSNSGSIFRPAAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGSSMLLFGVSLAC
YSPSLKSVQDQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQR
EQVISVGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPVDPNGKNIKKEVGKILCTDCATRPKLK
KMKSQTGEVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVE
DAGEYVCEAENILGKDTVRGRLHVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQL
SCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKK
QRRQMHHHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRREAETTFSGS
HSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNSPACVEARARRA
AAYSQEERRRAAMPPYHDSIDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFEITSPN
SAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGPGADMQRSYDSYYYPAAGPGPRRGACALG
GSLGSLPASPFRIPEDDEYETTQECAPPPPPRPRTRGASRRTSAGPRRWRRSRLNGLAAQRARA
ARDSLSLSSGSGCGSASASDDDADDADGALAAESTPFLGLRAAHDALRSDSPPLCPAADSRTYY
SLDSHSTRASSRHSRGPPTRAKQDSGPL

hide sequence

RefSeq Acc Id:

ENSRNOP00000028713 ⟸ ENSRNOT00000028713

RefSeq Acc Id:

ENSRNOP00000025901 ⟸ ENSRNOT00000025902

RefSeq Acc Id:

ENSRNOP00000093112 ⟸ ENSRNOT00000098732

RefSeq Acc Id:

ENSRNOP00000093404 ⟸ ENSRNOT00000097771

RefSeq Acc Id:

ENSRNOP00000087759 ⟸ ENSRNOT00000119243

RefSeq Acc Id:	XP_063133572 ⟸ XM_063277502
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6A510 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133571 ⟸ XM_063277501
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AHJ7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133573 ⟸ XM_063277503
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063133574 ⟸ XM_063277504
- Peptide Label:	isoform X4
- UniProtKB:	F1LM11 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133576 ⟸ XM_063277506
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063133575 ⟸ XM_063277505
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063133577 ⟸ XM_063277507
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_063133578 ⟸ XM_063277508
- Peptide Label:	isoform X8

Protein Domains

EGF-like Ig-like Ig-like C2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35569-F1-model_v2	AlphaFold	O35569	1-868	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303302	AgrOrtholog
BioCyc Gene	G2FUF-7882	BioCyc
Ensembl Genes	ENSRNOG00000019093	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025902.9	UniProtKB/TrEMBL
	ENSRNOT00000028713	ENTREZGENE
	ENSRNOT00000028713.8	UniProtKB/TrEMBL
	ENSRNOT00000097771.1	UniProtKB/TrEMBL
	ENSRNOT00000098732.1	UniProtKB/TrEMBL
	ENSRNOT00000119243.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	EGF-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_I-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neuregulin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neuregulin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:432361	UniProtKB/Swiss-Prot
NCBI Gene	432361	ENTREZGENE
PANTHER	PRO-NEUREGULIN-2, MEMBRANE-BOUND ISOFORM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	I-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neuregulin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nrg2	PhenoGen
PROSITE	EGF_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EGF_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019093	RatGTEx
SMART	IGc2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A510	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AHJ7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GKI5	ENTREZGENE, UniProtKB/TrEMBL
	A6J302_RAT	UniProtKB/TrEMBL
	D4A078	ENTREZGENE, UniProtKB/TrEMBL
	F1LM11	ENTREZGENE, UniProtKB/TrEMBL
	NRG2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	O35073	UniProtKB/Swiss-Prot
	O35570	UniProtKB/Swiss-Prot
	O35571	UniProtKB/Swiss-Prot
	O35572	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-14	Nrg2	neuregulin 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains Ig-like, EGF-like and hydrophobic domains similar to other neuregulins; member of EGF family	1304015
gene_expression	expressed in adult brain and thymus; expressed only in brain of E11.5 embryos	1304015
gene_physical_interaction	binds to ErbB3 and ErbB4 but not ErbB1 or ErbB2	1304015
gene_transcript	expressed as five alternatively spliced isoforms in PC-12 cells	1304015

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)