Advanced Search (OLGA)

Gene: Rab21 (RAB21, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab21

Name:

RAB21, member RAS oncogene family

RGD ID:

1303150

Description:

Predicted to enable G protein activity; GDP binding activity; and GTP binding activity. Involved in anterograde axonal transport and regulation of axon extension. Located in neuron projection. Is active in synapse. Orthologous to human RAB21 (RAB21, member RAS oncogene family); INTERACTS WITH bisphenol A; flutamide; gentamycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94502; ras-related protein Rab-21

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB21 (RAB21, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rab21 (RAB21, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAB21 (RAB21, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab21 (RAB21, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rab-21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab21	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	52,790,158 - 52,814,943 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	52,790,165 - 52,814,943 (-)	Ensembl				GRCr8
mRatBN7.2	7	50,904,050 - 50,928,890 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	50,904,057 - 50,928,839 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	52,810,830 - 52,835,615 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	55,013,914 - 55,038,699 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	54,791,894 - 54,816,679 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	58,261,985 - 58,286,770 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	58,261,992 - 58,286,770 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	58,270,887 - 58,295,672 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	54,550,247 - 54,575,032 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	47,696,205 - 47,720,990 (-)	NCBI		Celera
RGSC_v3.1	7	54,570,880 - 54,595,665 (-)	NCBI
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

obesity (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dimethoxyphenol (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

acrylamide (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furfural (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

nefazodone (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

temozolomide (ISO)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterograde axonal transport (IDA,IEA,ISO)

intracellular protein transport (IBA)

positive regulation of dendrite morphogenesis (IEA,ISO)

positive regulation of early endosome to late endosome transport (IEA,ISO)

positive regulation of receptor-mediated endocytosis (IEA,ISO)

protein stabilization (IEA,ISO,ISS)

protein transport (IEA)

Rab protein signal transduction (IEA)

regulation of axon extension (IDA)

regulation of exocytosis (IEA,ISO)

Cellular Component

axon cytoplasm (IEA)

cleavage furrow (IEA)

cytoplasmic side of early endosome membrane (IEA,ISO)

cytoplasmic side of plasma membrane (IEA,ISO)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

early endosome (IBA)

early endosome membrane (IEA)

endomembrane system (IBA)

endoplasmic reticulum membrane (IEA)

endosome (IEA,ISO)

Golgi apparatus (IEA)

Golgi cisterna membrane (IEA,ISO)

Golgi membrane (IEA)

neuron projection (IDA,IEA,ISO)

synapse (EXP,IDA)

trans-Golgi network (IEA,ISO)

vesicle membrane (IEA,ISO)

Molecular Function

G protein activity (IEA,ISO,ISS)

GDP binding (IEA,ISO,ISS)

GTP binding (IEA,ISO,ISS)

GTPase activity (IBA,IEA,ISO,ISS)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.	Burgo A, etal., Dev Cell. 2012 Jul 17;23(1):166-80. doi: 10.1016/j.devcel.2012.04.019. Epub 2012 Jun 14.
2.	Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.	Burgo A, etal., EMBO Rep. 2009 Oct;10(10):1117-24. doi: 10.1038/embor.2009.186. Epub 2009 Sep 11.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Expression of Rab small GTPases in epithelial Caco-2 cells: Rab21 is an apically located GTP-binding protein in polarised intestinal epithelial cells.	Opdam FJ, etal., Eur J Cell Biol 2000 May;79(5):308-16.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.

Additional References at PubMed

PMID:15561770	PMID:16034420	PMID:19056867	PMID:20458337	PMID:20937701	PMID:21423176	PMID:22171327	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Rab21
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	52,790,158 - 52,814,943 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	52,790,165 - 52,814,943 (-)	Ensembl				GRCr8
mRatBN7.2	7	50,904,050 - 50,928,890 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	50,904,057 - 50,928,839 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	52,810,830 - 52,835,615 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	55,013,914 - 55,038,699 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	54,791,894 - 54,816,679 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	58,261,985 - 58,286,770 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	58,261,992 - 58,286,770 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	58,270,887 - 58,295,672 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	54,550,247 - 54,575,032 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	47,696,205 - 47,720,990 (-)	NCBI		Celera
RGSC_v3.1	7	54,570,880 - 54,595,665 (-)	NCBI
Cytogenetic Map	7	q22	NCBI

RAB21
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	71,754,863 - 71,800,286 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	71,754,863 - 71,800,286 (+)	Ensembl			hg38	GRCh38
GRCh37	12	72,148,643 - 72,194,066 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	70,434,925 - 70,467,417 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	70,434,924 - 70,467,417	NCBI
Celera	12	71,810,833 - 71,843,321 (+)	NCBI		Celera
Cytogenetic Map	12	q21.1	NCBI
HuRef	12	69,197,233 - 69,230,012 (+)	NCBI		HuRef
CHM1_1	12	72,115,800 - 72,148,290 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	71,732,345 - 71,777,766 (+)	NCBI		T2T-CHM13v2.0

Rab21
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	115,125,767 - 115,151,540 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	115,122,989 - 115,151,499 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	115,289,862 - 115,317,419 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	115,287,084 - 115,315,594 (-)	Ensembl			mm10	GRCm38
MGSCv37	10	114,726,918 - 114,752,647 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	114,693,972 - 114,719,701 (-)	NCBI		MGSCv36	mm8
Celera	10	117,219,099 - 117,244,914 (-)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	63.51	NCBI

Rab21
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	11,765,857 - 11,777,192 (+)	Ensembl
ChiLan1.0	NW_004955405	11,766,674 - 11,778,637 (+)	NCBI	ChiLan1.0	ChiLan1.0

RAB21
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	79,783,659 - 79,818,267 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	79,780,063 - 79,814,666 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	69,278,191 - 69,309,143 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	72,137,432 - 72,171,844 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	72,137,432 - 72,171,844 (+)	Ensembl			panPan2	panpan1.1

RAB21
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	13,288,103 - 13,328,246 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	13,216,567 - 13,326,492 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	13,227,000 - 13,267,061 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	13,423,972 - 13,464,145 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	13,368,028 - 13,462,394 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	13,286,016 - 13,326,100 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	13,533,922 - 13,574,199 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	13,657,529 - 13,697,849 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab21
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	44,881,896 - 44,913,662 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936568	814,656 - 846,206 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936568	814,647 - 846,426 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB21
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	35,757,494 - 35,787,654 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	35,757,273 - 35,788,754 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	38,458,562 - 38,490,039 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB21
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	67,379,415 - 67,411,424 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	67,379,397 - 67,411,368 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	178,237,720 - 178,271,773 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab21
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	25,934,555 - 25,958,129 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624750	25,934,351 - 25,958,376 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab21
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	193,443,644 - 193,471,399 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab21
106 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	77
Count of miRNA genes:	62
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000005258
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	23807606	68807606	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	10517086	62346019	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	26638057	71638057	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	49137999	67614020	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	10112916	60150541	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	39845902	84845902	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	9460877	54460877	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	32998702	77998702	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	49682832	63890004	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	36178764	81178764	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	36178764	81178764	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	42996226	58678836	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	28624575	65788017	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	10498820	55498820	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	17460447	62460447	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
70207	Niddm31	Non-insulin dependent diabetes mellitus QTL 31	3.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	20057232	65057232	Rat
61439	Cia8	Collagen induced arthritis QTL 8	5.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	7	27182914	72182914	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005258 ⟹ ENSRNOP00000005258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	52,790,165 - 52,814,943 (-)	Ensembl
mRatBN7.2 Ensembl	7	50,904,057 - 50,928,839 (-)	Ensembl
Rnor_6.0 Ensembl	7	58,261,992 - 58,286,770 (-)	Ensembl

RefSeq Acc Id:

NM_001004238 ⟹ NP_001004238

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	52,790,158 - 52,814,943 (-)	NCBI
mRatBN7.2	7	50,904,050 - 50,928,839 (-)	NCBI
Rnor_6.0	7	58,261,985 - 58,286,770 (-)	NCBI
Rnor_5.0	7	58,270,887 - 58,295,672 (-)	NCBI
RGSC_v3.4	7	54,550,247 - 54,575,032 (-)	RGD
Celera	7	47,696,205 - 47,720,990 (-)	RGD

Sequence:

show sequence

GAGGTAGCTCTCTCCTAGCCTCGGGTCCCTGACGTGGTAGCCGGGGCCCTTCATTCTGGGACTT
TCTCTCGGCCCTCGCAGGCCTCGCCCGCTGGAGGACGCGGCGGGCACCGGGCTCGGCGGGGCGT
GAGAGAGCCGGGCCCGGGAGGAGCGGGCGCCGCGGCGGCGGTGGTGCGGGGCTCGGCGCGGCGC
TGGGCTCGGGCGGCGGGGCAGCGGCGGGATGGCTGCGGCCGGCGGCGGGGCGGCGGCGGCGGCG
GGCCGAGCCTACTCTTTTAAGGTGGTGCTGCTCGGAGAAGGCTGCGTGGGGAAGACGTCGCTGG
TGCTGCGCTACTGCGAGAACAAGTTCAACGACAAGCACATCACCACCCTGCAGGCTTCTTTCTT
AACAAAGAAGTTAAATATTGGTGGGAAGAGAGTAAACCTTGCTATATGGGATACAGCCGGTCAA
GAGAGATTCCATGCATTGGGTCCAATTTACTACCGAGATTCGAATGGAGCTATTTTAGTTTATG
ATGTAACAGATGAAGATTCTTTTCAGAAGGTAAAAAACTGGGTCAAAGAATTACGGAAAATGTT
GGGAAATGAAATCTGTTTGTGTATAGTTGGTAATAAAATAGACTTGGAAAAGGAGAGGCACGTC
TCCATTCAAGAAGCAGAATCGTATGCAGAGTCTGTGGGAGCAAAGCATTACCATACTTCTGCTA
AACAAAACAAAGGCATTGAGGAACTCTTTCTTGACCTTTGTAAAAGGATGATAGAAACGGCCCA
GGTGGATGAGAGGGCGAAGGGCAATGGCTCGAGTCAAGCAGGGGCTGCGAGGCGCGGCGTGCAG
ATCATCGACGACGAACCTCAAGCCCAGAGTGGCAGTGGAGGGTGCTGTTCTTCTGGGTAACGGC
TCACGCCTGCGAACTAAACAAAATGGAACTGTGGATCATCCCTCAACATGAAGACTGCCATATT
CCAAGTCACGTCATTTTACCAATGGAGTTAGAGAATTAACAGTATTTCCAATTACGTTTGTAAC
ACTGCAGAGACCTTAAGTGCTAAACTTAGTGGGGTTTGTGACAGAGGATTGGCATTTTCTACAA
ATGTTAACAAAGCAATTACCAATGGCCTTTTTACATATTTTTTCTTTAATGAGGAATAATATGC
ATGTAGAAAAGACCTACTTAAAGGCTTCATTTCTATTCTTTTAAATCAGATCTTTATTTAATAA
CTTATATATGATGTTGGAATGGTATACATTTTTGCAGTCCTTTGTATTTTGTGGTAGTTTGAAT
TGTATCACTTCTAAACAGCATACTGTTTTTGTTTTTGTTTTTTGATTAGCAGATACGTGAAGTT
CTATTTTTGCAGGGTTTGCACAGGCCCCTAACTGTCTACTACTTTGATATAATCTATAAACATC
CTGTATGCTGAGCTGATAAAATACATTGTAAATTACATATTAAATATTTTATCTGCTTTTACAA
GCGCAAGGTGCAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001004238	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79323	(Get FASTA)	NCBI Sequence Viewer
	EDM16693	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005258
	ENSRNOP00000005258.4
GenBank Protein	Q6AXT5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001004238 ⟸ NM_001004238

- UniProtKB:

Q6AXT5 (UniProtKB/Swiss-Prot), A6IGK5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGK
RVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIV
GNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNG
SSQAGAARRGVQIIDDEPQAQSGSGGCCSSG

hide sequence

Ensembl Acc Id:

ENSRNOP00000005258 ⟸ ENSRNOT00000005258

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXT5-F1-model_v2	AlphaFold	Q6AXT5	1-223	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695197

Promoter ID:

EPDNEW_R5722

Type:

initiation region

Name:

Rab21_1

Description:

RAB21, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	58,286,807 - 58,286,867	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303150	AgrOrtholog
BioCyc Gene	G2FUF-34066	BioCyc
Ensembl Genes	ENSRNOG00000003923	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005258	ENTREZGENE
	ENSRNOT00000005258.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7135453	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab21	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:299799	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94502	IMAGE-MGC_LOAD
NCBI Gene	299799	ENTREZGENE
PANTHER	PTHR47978	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab21	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003923	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A6IGK5	ENTREZGENE, UniProtKB/TrEMBL
	Q6AXT5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Rab21	RAB21, member RAS oncogene family			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Rab21	RAB21, member RAS oncogene family			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD