Symbol:
Selenok
Name:
selenoprotein K
RGD ID:
1303129
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress; positive regulation of cytokine production; and positive regulation of defense response to virus by host. Predicted to act upstream of or within several processes, including macrophage derived foam cell differentiation; positive regulation of leukocyte migration; and respiratory burst after phagocytosis. Predicted to be located in endoplasmic reticulum. Predicted to be active in Golgi apparatus and endoplasmic reticulum membrane. Orthologous to human SELENOK (selenoprotein K); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 4,4'-sulfonyldiphenol; acrylamide.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
heat shock protein; LOC290549; Selk
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SELENOK (selenoprotein K)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):
Selenok (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Selenok (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SELENOK (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SELENOK (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Selenok (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SELENOK (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SELENOK (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Selenok (selenoprotein K)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SELENOK (selenoprotein K)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Selenok (selenoprotein K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y41E3.8
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
selenok
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Selenok-ps1
Selenok-ps2
Selenok-ps3
Selenok-ps4
Selenok-ps5
Selenok-ps6
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 5,158,601 - 5,167,183 (+) NCBI GRCr8 mRatBN7.2 16 5,152,066 - 5,160,648 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 5,152,066 - 5,159,188 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 5,164,061 - 5,172,618 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 6,309,490 - 6,318,047 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 5,161,535 - 5,170,089 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 6,035,926 - 6,044,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 6,035,926 - 6,044,239 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 5,967,057 - 5,975,371 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 5,306,405 - 5,314,721 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 5,306,458 - 5,314,718 (+) NCBI Celera 16 10,023,918 - 10,032,235 (-) NCBI Celera Cytogenetic Map 16 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Selenok Rat 1,2-dimethylhydrazine multiple interactions ISO Selenok (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOK mRNA CTD PMID:22206623 Selenok Rat 1,2-dimethylhydrazine decreases expression ISO Selenok (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SELK mRNA CTD PMID:22206623 Selenok Rat 17beta-estradiol increases expression ISO SELENOK (Homo sapiens) 6480464 Estradiol results in increased expression of SELENOK mRNA CTD PMID:20106945 Selenok Rat 17beta-estradiol multiple interactions ISO SELENOK (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of SELENOK mRNA CTD PMID:22217510 Selenok Rat 17beta-estradiol decreases expression ISO SELENOK (Homo sapiens) 6480464 Estradiol results in decreased expression of SELENOK mRNA CTD PMID:23019147 Selenok Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SELENOK (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SELK mRNA CTD PMID:29581250 Selenok Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Selenok Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Selenok (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SELENOK mRNA CTD PMID:26377647 Selenok Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Selenok (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of SELENOK mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of SELENOK mRNA] CTD PMID:15034205 and PMID:16214954 Selenok Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Selenok (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SELENOK mRNA CTD PMID:15034205 and PMID:18796159 Selenok Rat 2-palmitoylglycerol increases expression ISO SELENOK (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SELENOK mRNA CTD PMID:37199045 Selenok Rat 4,4'-diaminodiphenylmethane decreases expression ISO Selenok (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SELENOK mRNA CTD PMID:18648102 Selenok Rat 4,4'-sulfonyldiphenol increases expression ISO Selenok (Mus musculus) 6480464 bisphenol S results in increased expression of SELENOK mRNA CTD PMID:39298647 Selenok Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA CTD PMID:36041667 Selenok Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SELK mRNA CTD PMID:28959563 Selenok Rat aflatoxin B1 decreases methylation ISO SELENOK (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SELENOK gene CTD PMID:27153756 Selenok Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SELENOK mRNA CTD PMID:16483693 Selenok Rat arsane multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat arsenic acid decreases expression ISO Selenok (Mus musculus) 6480464 arsenic acid results in decreased expression of SELENOK mRNA CTD PMID:19429247 Selenok Rat arsenic atom multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat arsenite(3-) decreases expression ISO Selenok (Mus musculus) 6480464 arsenite results in decreased expression of SELENOK mRNA CTD PMID:19429247 Selenok Rat arsenite(3-) multiple interactions ISO SELENOK (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to SELENOK mRNA] CTD PMID:32406909 Selenok Rat benzo[a]pyrene increases expression ISO Selenok (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SELENOK mRNA CTD PMID:15034205 and PMID:22228805 Selenok Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of SELENOK mRNA CTD PMID:38278498 Selenok Rat benzo[a]pyrene decreases methylation ISO SELENOK (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SELK promoter CTD PMID:27901495 Selenok Rat benzo[a]pyrene multiple interactions ISO Selenok (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of SELENOK mRNA] CTD PMID:15034205 Selenok Rat Benzo[k]fluoranthene increases expression ISO Selenok (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of SELENOK mRNA CTD PMID:26377693 Selenok Rat beta-lapachone increases expression ISO SELENOK (Homo sapiens) 6480464 beta-lapachone results in increased expression of SELENOK mRNA CTD PMID:38218311 Selenok Rat bis(2-ethylhexyl) phthalate increases expression ISO Selenok (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SELENOK mRNA CTD PMID:33754040 Selenok Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SELENOK mRNA CTD PMID:25181051 Selenok Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA CTD PMID:36041667 Selenok Rat bisphenol A increases expression ISO Selenok (Mus musculus) 6480464 bisphenol A results in increased expression of SELENOK mRNA CTD PMID:33221593 Selenok Rat bisphenol A affects expression ISO SELENOK (Homo sapiens) 6480464 bisphenol A affects the expression of SELK mRNA CTD PMID:30903817 Selenok Rat bisphenol F multiple interactions ISO SELENOK (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of SELENOK gene CTD PMID:31601247 Selenok Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SELENOK mRNA CTD PMID:36041667 Selenok Rat bisphenol F decreases expression ISO Selenok (Mus musculus) 6480464 bisphenol F results in decreased expression of SELENOK mRNA CTD PMID:38685157 Selenok Rat bortezomib increases expression ISO SELENOK (Homo sapiens) 6480464 Bortezomib results in increased expression of SELENOK mRNA CTD PMID:20977926 Selenok Rat cadmium dichloride increases expression ISO SELENOK (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SELENOK mRNA CTD PMID:38568856 Selenok Rat CGP 52608 multiple interactions ISO SELENOK (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SELK gene] CTD PMID:28238834 Selenok Rat ciguatoxin CTX1B affects expression ISO Selenok (Mus musculus) 6480464 Ciguatoxins affects the expression of SELENOK mRNA CTD PMID:18353800 Selenok Rat cisplatin increases expression ISO SELENOK (Homo sapiens) 6480464 Cisplatin results in increased expression of SELENOK mRNA CTD PMID:19561079 Selenok Rat clobetasol increases expression ISO Selenok (Mus musculus) 6480464 Clobetasol results in increased expression of SELENOK mRNA CTD PMID:27462272 Selenok Rat cobalt dichloride increases expression ISO SELENOK (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SELENOK mRNA CTD PMID:19320972 Selenok Rat copper atom multiple interactions ISO SELENOK (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SELENOK mRNA CTD PMID:20971185 Selenok Rat copper(0) multiple interactions ISO SELENOK (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SELENOK mRNA CTD PMID:20971185 Selenok Rat copper(II) chloride increases expression ISO SELENOK (Homo sapiens) 6480464 cupric chloride results in increased expression of SELENOK mRNA CTD PMID:17211630 Selenok Rat copper(II) sulfate increases expression ISO SELENOK (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SELENOK mRNA CTD PMID:19549813 Selenok Rat cyclosporin A increases expression ISO SELENOK (Homo sapiens) 6480464 Cyclosporine results in increased expression of SELENOK mRNA CTD PMID:20106945 more ... Selenok Rat Dibutyl phosphate affects expression ISO SELENOK (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SELENOK mRNA CTD PMID:37042841 Selenok Rat dibutyl phthalate increases expression ISO Selenok (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of SELENOK mRNA CTD PMID:21266533 Selenok Rat dicrotophos decreases expression ISO SELENOK (Homo sapiens) 6480464 dicrotophos results in decreased expression of SELENOK mRNA CTD PMID:28302478 Selenok Rat dioxygen multiple interactions ISO Selenok (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of SELENOK mRNA] CTD PMID:22629407 Selenok Rat dioxygen increases expression ISO Selenok (Mus musculus) 6480464 Oxygen deficiency results in increased expression of SELENOK mRNA CTD PMID:22629407 Selenok Rat disodium selenite increases expression ISO SELENOK (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SELENOK mRNA CTD PMID:18175754 Selenok Rat diuron decreases expression ISO SELENOK (Homo sapiens) 6480464 Diuron results in decreased expression of SELENOK mRNA CTD PMID:35967413 Selenok Rat doxorubicin increases expression ISO SELENOK (Homo sapiens) 6480464 Doxorubicin results in increased expression of SELENOK mRNA CTD PMID:29803840 Selenok Rat elemental selenium affects expression EXP 6480464 Selenium affects the expression of SELENOK mRNA CTD PMID:19106321 Selenok Rat ethanol affects splicing ISO Selenok (Mus musculus) 6480464 Ethanol affects the splicing of SELK mRNA CTD PMID:30319688 Selenok Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SELENOK mRNA CTD PMID:24136188 Selenok Rat folic acid multiple interactions ISO Selenok (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SELENOK mRNA CTD PMID:22206623 Selenok Rat fulvestrant multiple interactions ISO SELENOK (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of SELENOK gene CTD PMID:31601247 Selenok Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SELENOK mRNA CTD PMID:33387578 Selenok Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of SELENOK mRNA CTD PMID:24136188 Selenok Rat manganese atom multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat manganese(0) multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat manganese(II) chloride multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat miconazole increases expression ISO Selenok (Mus musculus) 6480464 Miconazole results in increased expression of SELENOK mRNA CTD PMID:27462272 Selenok Rat nickel atom increases expression ISO SELENOK (Homo sapiens) 6480464 Nickel results in increased expression of SELENOK mRNA CTD PMID:23195993 Selenok Rat nickel sulfate increases expression ISO SELENOK (Homo sapiens) 6480464 nickel sulfate results in increased expression of SELENOK mRNA CTD PMID:16780908 Selenok Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of SELENOK mRNA CTD PMID:24136188 Selenok Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SELENOK mRNA CTD PMID:33387578 Selenok Rat reactive oxygen species affects abundance ISO SELENOK (Homo sapiens) 6480464 SELENOK protein affects the abundance of Reactive Oxygen Species CTD PMID:16962588 Selenok Rat selenium atom affects expression EXP 6480464 Selenium affects the expression of SELENOK mRNA CTD PMID:19106321 Selenok Rat silver atom increases expression ISO SELENOK (Homo sapiens) 6480464 Silver results in increased expression of SELK mRNA CTD PMID:26014281 Selenok Rat silver(0) increases expression ISO SELENOK (Homo sapiens) 6480464 Silver results in increased expression of SELK mRNA CTD PMID:26014281 Selenok Rat sodium arsenite increases expression ISO SELENOK (Homo sapiens) 6480464 sodium arsenite results in increased expression of SELENOK mRNA CTD PMID:38568856 Selenok Rat sodium arsenite multiple interactions ISO SELENOK (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SELENOK mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SELENOK mRNA CTD PMID:39836092 Selenok Rat sodium arsenite decreases expression ISO SELENOK (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SELENOK mRNA CTD PMID:34032870 Selenok Rat tert-butyl hydroperoxide decreases expression ISO Selenok (Mus musculus) 6480464 tert-Butylhydroperoxide results in decreased expression of SELENOK mRNA CTD PMID:15003993 Selenok Rat thiram increases expression ISO SELENOK (Homo sapiens) 6480464 Thiram results in increased expression of SELENOK mRNA CTD PMID:38568856 Selenok Rat titanium dioxide decreases methylation ISO Selenok (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SELK gene CTD PMID:35295148 Selenok Rat triphenyl phosphate affects expression ISO SELENOK (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SELENOK mRNA CTD PMID:37042841 Selenok Rat tunicamycin increases expression ISO SELENOK (Homo sapiens) 6480464 Tunicamycin results in increased expression of SELK mRNA CTD PMID:29453283 Selenok Rat valproic acid increases expression ISO SELENOK (Homo sapiens) 6480464 Valproic Acid results in increased expression of SELK mRNA CTD PMID:29154799 Selenok Rat valproic acid affects expression ISO SELENOK (Homo sapiens) 6480464 Valproic Acid affects the expression of SELENOK mRNA CTD PMID:25979313
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-palmitoylglycerol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acrylamide (EXP) aflatoxin B1 (ISO) ammonium chloride (EXP) arsane (ISO) arsenic acid (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bortezomib (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clobetasol (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (ISO) doxorubicin (ISO) elemental selenium (EXP) ethanol (ISO) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) gentamycin (EXP) glafenine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) miconazole (ISO) nickel atom (ISO) nickel sulfate (ISO) nimesulide (EXP) paracetamol (EXP) reactive oxygen species (ISO) selenium atom (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) tert-butyl hydroperoxide (ISO) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO)
Biological Process
calcium ion transport (IBA,IEA,ISO) endoplasmic reticulum calcium ion homeostasis (IBA) establishment of localization in cell (IEA,ISO) intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (IEA,ISO) macrophage derived foam cell differentiation (IEA,ISO) monoatomic ion transport (IEA) neutrophil migration (IEA,ISO) positive regulation of chemokine production (IEA,ISO) positive regulation of defense response to virus by host (IEA,ISO) positive regulation of interleukin-6 production (IEA,ISO) positive regulation of monocyte chemotactic protein-1 production (IEA,ISO) positive regulation of neutrophil migration (IEA,ISO) positive regulation of T cell migration (IEA,ISO) positive regulation of T cell proliferation (IEA,ISO) positive regulation of tumor necrosis factor production (IEA,ISO) protein palmitoylation (ISO,ISS) regulation of calcium-mediated signaling (IEA,ISO) regulation of protein transport (IEA,ISO) regulation of store-operated calcium entry (ISO) respiratory burst after phagocytosis (IEA,ISO) response to oxidative stress (IEA,ISO) T cell migration (IEA,ISO) T cell proliferation (IEA,ISO)
Selenok (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 5,158,601 - 5,167,183 (+) NCBI GRCr8 mRatBN7.2 16 5,152,066 - 5,160,648 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 5,152,066 - 5,159,188 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 5,164,061 - 5,172,618 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 6,309,490 - 6,318,047 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 5,161,535 - 5,170,089 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 6,035,926 - 6,044,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 6,035,926 - 6,044,239 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 5,967,057 - 5,975,371 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 5,306,405 - 5,314,721 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 5,306,458 - 5,314,718 (+) NCBI Celera 16 10,023,918 - 10,032,235 (-) NCBI Celera Cytogenetic Map 16 p16 NCBI
SELENOK (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 53,884,417 - 53,891,859 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 53,884,417 - 53,891,885 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 53,918,444 - 53,925,886 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 53,894,266 - 53,901,029 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 53,886,504 - 53,893,267 (-) NCBI Celera Cytogenetic Map 3 p21.1 NCBI HuRef 3 53,967,743 - 53,974,504 (-) NCBI HuRef CHM1_1 3 53,870,843 - 53,877,606 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 53,917,657 - 53,925,099 (-) NCBI T2T-CHM13v2.0
Selenok (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 29,690,337 - 29,697,031 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 29,690,265 - 29,697,619 (+) Ensembl GRCm39 Ensembl GRCm38 14 29,968,380 - 29,975,074 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 29,968,308 - 29,975,662 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 30,781,566 - 30,788,260 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 28,797,426 - 28,804,083 (+) NCBI MGSCv36 mm8 Celera 14 26,224,212 - 26,230,906 (+) NCBI Celera Cytogenetic Map 14 A3 NCBI cM Map 14 18.36 NCBI
Selenok (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955430 3,870,925 - 3,876,636 (-) NCBI ChiLan1.0 ChiLan1.0
SELENOK (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 53,877,081 - 53,883,873 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 53,881,755 - 53,888,643 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 53,823,135 - 53,829,957 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 55,044,026 - 55,050,960 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 55,044,789 - 55,047,450 (-) Ensembl panpan1.1 panPan2
SELENOK (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 36,109,095 - 36,115,792 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 36,109,148 - 36,115,856 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 36,046,592 - 36,053,289 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 36,383,192 - 36,389,892 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 36,383,245 - 36,389,965 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 35,825,109 - 35,831,800 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 36,183,706 - 36,190,402 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 36,400,934 - 36,407,849 (+) NCBI UU_Cfam_GSD_1.0
Selenok (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 171,407,613 - 171,414,243 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 4,545,961 - 4,552,822 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 4,546,186 - 4,552,764 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SELENOK (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 35,990,182 - 35,996,853 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 35,989,461 - 35,996,824 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 39,060,209 - 39,067,575 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SELENOK (Chlorocebus sabaeus - green monkey)
Selenok (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 59 Count of miRNA genes: 50 Interacting mature miRNAs: 57 Transcripts: ENSRNOT00000020284 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 1357403 Slep4 Serum leptin concentration QTL 4 3.91 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 9639137 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 737825 Alc13 Alcohol consumption QTL 13 4.5 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 16039848 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 61372 Bp40 Blood pressure QTL 40 2.2 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 16 4227730 17696785 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 2301406 Kidm39 Kidney mass QTL 39 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 16 2851709 15884239 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
BF389195
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 5,156,741 - 5,156,985 (+) MAPPER mRatBN7.2 Rnor_6.0 16 6,040,602 - 6,040,845 NCBI Rnor6.0 Rnor_5.0 16 5,971,733 - 5,971,976 UniSTS Rnor5.0 RGSC_v3.4 16 5,311,081 - 5,311,326 UniSTS RGSC3.4 Celera 16 10,027,313 - 10,027,556 UniSTS RH 3.4 Map 16 11.4 UniSTS Cytogenetic Map 16 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020284 ⟹ ENSRNOP00000020284
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 5,152,066 - 5,159,188 (+) Ensembl Rnor_6.0 Ensembl 16 6,035,926 - 6,044,239 (+) Ensembl
RefSeq Acc Id:
NM_207589 ⟹ NP_997472
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 5,158,601 - 5,167,183 (+) NCBI mRatBN7.2 16 5,152,066 - 5,160,648 (+) NCBI Rnor_6.0 16 6,035,926 - 6,044,240 (+) NCBI Rnor_5.0 16 5,967,057 - 5,975,371 (+) NCBI RGSC_v3.4 16 5,306,405 - 5,314,721 (+) RGD Celera 16 10,023,918 - 10,032,235 (-) RGD
Sequence:
GACGTAAGGGTGGGGCGGGAGGGGAGGTACGGCAACATCAGGGCGTCCGGTCTTCTCTGTCGCTAGGAAGCGGGCAACCGGAGGAAAGATGGTTTACATCTCGAATGGTCAGGTGTTAGACAGCCGGA ATCAGTCCCCCTGGAGATTGTCTTTCATAACAGATTTCTTCTGGGGAATAGCAGAATTTGTGGTTTTTTTTTTCAAAACTCTGCTTCAGCAAGATGTGAAGAAAAGAAGAGGCTACGGGGGCTCCTCT GATTCCAGATATGATGACGGAAGAGGGCCACCAGGAAACCCTCCACGAAGAATGGGTCGGATCAGTCACCTTCGTGGCCCCAGCCCTCCTCCAATGGCCGGTGGATGAGGAAGGTAAACGTCTGCTCT GAGAAGCAGACAACTAGACATACACGCCTAGAAGGGAACCATCAAGAGGTGAGGAGCGGCTCATGAGGAGAAGATGGTGTATGTCCAAACAAGGACTGCTCTGTGTCCTCACAGAAGAATGAGGTCAT GCTGGGAACTCCCTCTGCAGGATCTGGCCTGACTGATGTGCAGTTCTATAAATGTACATGTGTGTCTCCTTATCTGTTTTGTATAGTTCACTAAAGTTAATATAGATTTAAGAAGTAAATATTTTTAG GTTGCAAAACTTGATTCTTCATCTTTATATGATTATACCCAAAATCCTTGATCTGGAAGAAATAAAGGCCATGTAGTTAGTCCTGGAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_997472 ⟸ NM_207589
- UniProtKB:
Q5I0Q3 (UniProtKB/Swiss-Prot), P59798 (UniProtKB/Swiss-Prot), A0A0G2JSN7 (UniProtKB/TrEMBL)
- Sequence:
MVYISNGQVLDSRNQSPWRLSFITDFFWGIAEFVVFFFKTLLQQDVKKRRGYGGSSDSRYDDGRGPPGNPPRRMGRISHLRGPSPPPMAGGUGR
hide sequence
Ensembl Acc Id:
ENSRNOP00000020284 ⟸ ENSRNOT00000020284
RGD ID: 13699906
Promoter ID: EPDNEW_R10430
Type: initiation region
Name: Selenok_1
Description: selenoprotein K
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 6,035,977 - 6,036,037 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-09-28
Selenok
selenoprotein K
Selk
selenoprotein K
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-04
Selk
selenoprotein K
LOC290549
heat shock protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-07-11
LOC290549
heat shock protein
Symbol and Name status set to provisional
70820
PROVISIONAL