Advanced Search (OLGA)

Gene: Or10s1 (olfactory receptor family 10 subfamily S member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or10s1

Name:

olfactory receptor family 10 subfamily S member 1

RGD ID:

1333299

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be active in plasma membrane. Orthologous to human OR10S1 (olfactory receptor family 10 subfamily S member 1); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1337; olfactory receptor gene Olr1337; olfactory receptor Olr1337; Olr1337; ratchr8-42975013-42975966_ORF

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	49,274,175 - 49,275,225 (+)	NCBI		GRCr8
mRatBN7.2	8	40,377,018 - 40,378,068 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	40,377,103 - 40,378,068 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	45,861,309 - 45,862,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	44,145,361 - 44,146,314 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	42,007,501 - 42,008,454 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	43,872,728 - 43,873,681 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	43,872,728 - 43,873,681 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	61,647,010 - 61,647,963 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	42,966,247 - 42,967,200 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	42,975,012 - 42,975,966 (+)	NCBI
Celera	8	40,001,975 - 40,002,928 (+)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	chromosome 11 partial duplication syndrome		ISO	OR10S1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Distal trisomy 11q	ClinVar	PMID:25741868
Or10s1	Rat	Dwarfism		ISO	OR10S1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:32581362
Or10s1	Rat	holoprosencephaly 11		ISO	OR10S1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Holoprosencephaly 11	ClinVar	PMID:28492532
Or10s1	Rat	schizophrenia		ISO	OR10S1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Or10s1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or10s1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Or10s1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or10s1	Rat	2,2',5,5'-tetrachlorobiphenyl	affects expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Or10s1	Rat	2-palmitoylglycerol	increases expression	ISO	OR10S1 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of OR10S1 mRNA	CTD	PMID:37199045
Or10s1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of OR10S1 mRNA	CTD	PMID:24780913
Or10s1	Rat	benzo[a]pyrene	increases methylation	ISO	OR10S1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of OR10S1 exon and Benzo(a)pyrene results in increased methylation of OR10S1 promoter	CTD	PMID:27901495
Or10s1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR10S1 mRNA	CTD	PMID:25181051
Or10s1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of OR10S1 gene	CTD	PMID:28505145
Or10s1	Rat	CGP 52608	multiple interactions	ISO	OR10S1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR10S1 gene]	CTD	PMID:28238834
Or10s1	Rat	PCB138	multiple interactions	ISO	Or10s1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or10s1	Rat	PCB138	decreases expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Or10s1	Rat	sodium arsenite	decreases expression	ISO	OR10S1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of OR10S1 mRNA	CTD	PMID:34032870

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IBA	MGI:106182 and PANTHER:PTN002818000	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or10s1	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10s1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10s1	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10s1	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or10s1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or10s1	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10s1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or10s1	Rat	plasma membrane	is_active_in	IBA	MGI:106648 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or10s1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10s1	Rat	olfactory receptor activity	enables	IBA	MGI:106182 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or10s1	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10s1	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10s1	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or10s1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	49,274,175 - 49,275,225 (+)	NCBI		GRCr8
mRatBN7.2	8	40,377,018 - 40,378,068 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	40,377,103 - 40,378,068 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	45,861,309 - 45,862,262 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	44,145,361 - 44,146,314 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	42,007,501 - 42,008,454 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	43,872,728 - 43,873,681 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	43,872,728 - 43,873,681 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	61,647,010 - 61,647,963 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	42,966,247 - 42,967,200 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	42,975,012 - 42,975,966 (+)	NCBI
Celera	8	40,001,975 - 40,002,928 (+)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

OR10S1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	123,976,661 - 123,977,781 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	123,976,661 - 123,977,781 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	123,847,368 - 123,848,488 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	123,352,613 - 123,353,608 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	123,352,612 - 123,353,608	NCBI
Celera	11	121,006,598 - 121,007,593 (-)	NCBI		Celera
Cytogenetic Map	11	q24.1	NCBI
HuRef	11	119,788,191 - 119,789,186 (-)	NCBI		HuRef
CHM1_1	11	123,733,565 - 123,734,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	124,005,286 - 124,006,406 (-)	NCBI		T2T-CHM13v2.0

Or10s1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	39,985,593 - 39,986,558 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	39,985,125 - 39,990,700 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	40,074,297 - 40,075,262 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	40,073,829 - 40,079,404 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	39,881,882 - 39,882,847 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	39,824,868 - 39,825,833 (+)	NCBI		MGSCv36	mm8
Celera	9	37,313,177 - 37,314,142 (+)	NCBI		Celera
Cytogenetic Map	9	A5.1	NCBI
cM Map	9	21.36	NCBI

LOC100970443
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	124,673,549 - 124,674,514 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	125,778,019 - 125,778,984 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	118,805,119 - 118,806,084 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	122,722,014 - 122,722,979 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

OR10S1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	10,509,352 - 10,510,380 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	10,509,385 - 10,510,380 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	10,565,627 - 10,566,655 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	10,458,618 - 10,459,646 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	10,458,651 - 10,459,646 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	10,525,522 - 10,526,550 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	10,494,179 - 10,495,207 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	10,539,927 - 10,540,955 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101964472
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	105,451,074 - 105,452,063 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936542	8,372,483 - 8,373,478 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936542	8,372,483 - 8,373,472 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100512247
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	50,909,148 - 50,910,113 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	50,909,148 - 50,910,125 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	56,139,991 - 56,140,986 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants in Or10s1
6 total Variants

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	42692818	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	30848154	40713225	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	nervous system	reproductive system
2	1	2	7


RefSeq Transcripts	NM_001000480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000079702 ⟹ ENSRNOP00000069537

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	40,377,103 - 40,378,068 (+)	Ensembl
Rnor_6.0 Ensembl	8	43,872,728 - 43,873,681 (+)	Ensembl

RefSeq Acc Id:

NM_001000480 ⟹ NP_001000480

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	49,274,272 - 49,275,225 (+)	NCBI
mRatBN7.2	8	40,377,115 - 40,378,068 (+)	NCBI
Rnor_6.0	8	43,872,728 - 43,873,681 (+)	NCBI
Rnor_5.0	8	61,647,010 - 61,647,963 (-)	NCBI
RGSC_v3.4	8	42,966,247 - 42,967,200 (+)	RGD
Celera	8	40,001,975 - 40,002,928 (+)	RGD

Sequence:

show sequence

ATGCAGTCCCTTAACCAGTCTGTGGTGAGCCACTTCCTCCTGGAGGGGCTGACATACACGGCTGAGCACCCTGGCCTTTTCTTCCTCCTCTTTCTCCTCATCTACAGTATCACTGTGAGTGGCAATCT
CCTCATTCTCCTTACTGTGGGCTGTGACCCTCATCTCCGCTCCCCTATGTACCACTTCCTGGGACACCTCTCCTTCCTTGATGCATGTCTGTCTACAGTAACAGTGCCCAAGGTCATGGCAGGCCTGC
TGGCTTTGGATGGGAAAGTGATCTCCTTCCAGGGCTGTGCTCTCCAACTTTATTGCTTCCACTTCCTGGCCAGCACTGAGTGTTTTTTGTACACAGTCATGGCCTATGACCGTTACCTTGCCATCTGT
CAGCCCCTGCACTACCCAGTGGTCATGAACAAGCGGTTGTGTGCAGGGCTGGCTGGGAGCACTTGGGCTATAGGTGCTTTGCACTCCACAATTCAAACTTCCCTAACCTTCCGCCTGCTGTACTGTGG
GCCCCAGAAGATTGCCTACTTCTTCTGTGACATCCCTCCAGTGCTGAAGCTGGCCTGTGCAGACACCAGCATCAACGAGATTGTCATGCTTGCAAACATTGGTGTGGTGGCTGCAGGCTGCCTCATCC
TCATCGTCATCTCCTACGTCTTCATTGTGGCTGCAGTGCTGCGCATTCGCACAGCGGAGGGACGGCAGCGAGCCTTCTCCACTTGCACAGCGCATCTCACAGTGGTGCTCCTGTACTACATGCCCCCA
GTCTGTATCTACCTACAGCCAAGCTCCACGGGCACGGGGGCGGGCGCTCCAGCAGTCTTCTACACAATAGTCACTCCGATGCTCAATCCTTTCATCTACACACTGAGAAACAAGGAAGTCAAGCGGGC
TCTGAGAAGGTTGGTATTTAGCTCCCGAGAGTCTCCAGCAAGCAGCCCAGCCCCCTAA

hide sequence

RefSeq Acc Id:

XM_039081028 ⟹ XP_038936956

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	49,274,175 - 49,275,225 (+)	NCBI
mRatBN7.2	8	40,377,018 - 40,378,068 (+)	NCBI


Protein RefSeqs	NP_001000480	(Get FASTA)	NCBI Sequence Viewer
	XP_038936956	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL95216	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069537
	ENSRNOP00000069537.2

RefSeq Acc Id:

NP_001000480 ⟸ NM_001000480

- UniProtKB:

A0A0G2JVM1 (UniProtKB/TrEMBL), A6J3P3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQSLNQSVVSHFLLEGLTYTAEHPGLFFLLFLLIYSITVSGNLLILLTVGCDPHLRSPMYHFLGHLSFLDACLSTVTVPKVMAGLLALDGKVISFQGCALQLYCFHFLASTECFLYTVMAYDRYLAIC
QPLHYPVVMNKRLCAGLAGSTWAIGALHSTIQTSLTFRLLYCGPQKIAYFFCDIPPVLKLACADTSINEIVMLANIGVVAAGCLILIVISYVFIVAAVLRIRTAEGRQRAFSTCTAHLTVVLLYYMPP
VCIYLQPSSTGTGAGAPAVFYTIVTPMLNPFIYTLRNKEVKRALRRLVFSSRESPASSPAP

hide sequence

Ensembl Acc Id:

ENSRNOP00000069537 ⟸ ENSRNOT00000079702

RefSeq Acc Id:	XP_038936956 ⟸ XM_039081028
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JVM1 (UniProtKB/TrEMBL), A6J3P3 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JVM1-F1-model_v2	AlphaFold	A0A0G2JVM1	1-317	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-30853	BioCyc
Ensembl Genes	ENSRNOG00000058978	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000079702	ENTREZGENE
	ENSRNOT00000079702.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
NCBI Gene	300637	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or10s1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000058978	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A0G2JVM1	ENTREZGENE, UniProtKB/TrEMBL
	A6J3P3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or10s1	olfactory receptor family 10 subfamily S member 1	Olr1337	olfactory receptor 1337	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1337	olfactory receptor 1337	Olr1337_predicted	olfactory receptor 1337 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1337_predicted	olfactory receptor 1337 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype