Symbol:
Myo5c
Name:
myosin VC
RGD ID:
1309994
Description:
Predicted to enable actin filament binding activity and microfilament motor activity. Predicted to be involved in actin filament organization and endocytosis. Predicted to be part of myosin complex. Predicted to be active in actin cytoskeleton; cytoplasm; and membrane. Orthologous to human MYO5C (myosin VC); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC315820; myosin-Vc; unconventional myosin-Vc
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYO5C (myosin VC) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Myo5c (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myo5c (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYO5C (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYO5C (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myo5c (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYO5C (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYO5C (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myo5c (myosin VC) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MYO5C (myosin VC)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Myo5c (myosin VC)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
myo5c (myosin VC)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
didum
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
hum-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 84,870,031 - 84,946,996 (+) NCBI GRCr8 mRatBN7.2 8 75,989,497 - 76,066,485 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 75,989,528 - 76,066,483 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 81,496,835 - 81,574,055 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 79,761,746 - 79,838,757 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 77,596,161 - 77,673,391 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 82,171,296 - 82,248,109 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 82,171,497 - 82,247,544 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 81,771,484 - 81,851,384 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 80,101,971 - 80,119,034 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 80,057,940 - 80,136,830 (+) NCBI Celera 8 75,779,366 - 75,856,253 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Myo5c Rat Bloom syndrome ISO RGD:1320640 8554872 ClinVar Annotator: match by term: Bloom syndrome ClinVar PMID:28492532 Myo5c Rat colorectal cancer ISO RGD:1320640 8554872 ClinVar Annotator: match by term: Familial colorectal cancer ClinVar PMID:28492532 Myo5c Rat paraplegia ISO RGD:1320640 8554872 ClinVar Annotator: match by term: Spastic paraplegia ClinVar PMID:21620353|PMID:21937992|PMID:23472171|PMID:28492532|PMID:30237576|PMID:30732576|PMID:31688942
Only show annotations with direct experimental evidence (0 objects hidden)
Myo5c Rat (+)-catechin multiple interactions ISO RGD:1320640 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of MYO5C mRNA CTD PMID:24763279 Myo5c Rat 1,2-dichloroethane decreases expression ISO RGD:1551407 6480464 ethylene dichloride results in decreased expression of MYO5C mRNA CTD PMID:28960355 Myo5c Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1551407 6480464 1,2-Dimethylhydrazine results in decreased expression of MYO5C mRNA CTD PMID:22206623 Myo5c Rat 17beta-estradiol multiple interactions ISO RGD:1320640 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of MYO5C mRNA CTD PMID:30165855 Myo5c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1320640 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYO5C mRNA CTD PMID:21632981 Myo5c Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1551407 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYO5C mRNA CTD PMID:33956508 Myo5c Rat 3-Nitrobenzanthrone decreases expression ISO RGD:1320640 6480464 3-nitrobenzanthrone results in decreased expression of MYO5C mRNA CTD PMID:34036453 Myo5c Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1551407 6480464 bisphenol S results in increased expression of MYO5C mRNA CTD PMID:30951980 Myo5c Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1551407 6480464 bisphenol S affects the methylation of MYO5C gene CTD PMID:31683443 Myo5c Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MYO5C mRNA CTD PMID:30047161 Myo5c Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of MYO5C mRNA CTD PMID:28959563 Myo5c Rat aflatoxin B1 increases methylation ISO RGD:1320640 6480464 Aflatoxin B1 results in increased methylation of MYO5C exon CTD PMID:30157460 Myo5c Rat all-trans-retinoic acid decreases expression ISO RGD:1320640 6480464 Tretinoin results in decreased expression of MYO5C mRNA CTD PMID:23724009 Myo5c Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MYO5C mRNA CTD PMID:30047161 Myo5c Rat antirheumatic drug increases expression ISO RGD:1320640 6480464 Antirheumatic Agents results in increased expression of MYO5C mRNA CTD PMID:24449571 Myo5c Rat arsane affects methylation ISO RGD:1320640 6480464 Arsenic affects the methylation of MYO5C gene CTD PMID:25304211 Myo5c Rat arsane multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat arsenic atom affects methylation ISO RGD:1320640 6480464 Arsenic affects the methylation of MYO5C gene CTD PMID:25304211 Myo5c Rat arsenic atom multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat arsenite(3-) multiple interactions ISO RGD:1320640 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MYO5C mRNA] CTD PMID:32406909 Myo5c Rat arsenous acid decreases response to substance ISO RGD:1320640 6480464 MYO5C protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Myo5c Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of MYO5C gene CTD PMID:35440735 Myo5c Rat azathioprine decreases expression ISO RGD:1320640 6480464 Azathioprine results in decreased expression of MYO5C mRNA CTD PMID:22623647 Myo5c Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of MYO5C mRNA CTD PMID:21839799 Myo5c Rat benzo[a]pyrene affects methylation ISO RGD:1320640 6480464 Benzo(a)pyrene affects the methylation of MYO5C exon; Benzo(a)pyrene affects the methylation of MYO5C promoter CTD PMID:27901495|PMID:30157460 Myo5c Rat benzo[a]pyrene decreases expression ISO RGD:1320640 6480464 Benzo(a)pyrene results in decreased expression of MYO5C mRNA CTD PMID:20106945|PMID:21632981|PMID:26238291 Myo5c Rat benzo[e]pyrene increases methylation ISO RGD:1320640 6480464 benzo(e)pyrene results in increased methylation of MYO5C exon CTD PMID:30157460 Myo5c Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1551407 6480464 Diethylhexyl Phthalate results in decreased expression of MYO5C mRNA CTD PMID:34319233 Myo5c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYO5C mRNA CTD PMID:25181051 Myo5c Rat bisphenol A decreases expression ISO RGD:1551407 6480464 bisphenol A results in decreased expression of MYO5C mRNA CTD PMID:32156529 Myo5c Rat bisphenol A multiple interactions ISO RGD:1320640 6480464 [Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of MYO5C protein CTD PMID:31629898 Myo5c Rat bisphenol A increases expression ISO RGD:1551407 6480464 bisphenol A results in increased expression of MYO5C mRNA CTD PMID:25594700 Myo5c Rat bisphenol F increases expression ISO RGD:1551407 6480464 bisphenol F results in increased expression of MYO5C mRNA CTD PMID:30951980 Myo5c Rat bisphenol F decreases expression ISO RGD:1551407 6480464 bisphenol F results in decreased expression of MYO5C mRNA CTD PMID:38685157 Myo5c Rat butanal decreases expression ISO RGD:1320640 6480464 butyraldehyde results in decreased expression of MYO5C mRNA CTD PMID:26079696 Myo5c Rat carbon nanotube decreases expression ISO RGD:1551407 6480464 Nanotubes, Carbon analog results in decreased expression of MYO5C mRNA CTD PMID:25554681 Myo5c Rat CGP 52608 multiple interactions ISO RGD:1320640 6480464 CGP 52608 promotes the reaction [RORA protein binds to MYO5C gene] CTD PMID:28238834 Myo5c Rat cisplatin decreases expression ISO RGD:1320640 6480464 Cisplatin results in decreased expression of MYO5C mRNA CTD PMID:27392435 Myo5c Rat cobalt dichloride decreases expression ISO RGD:1320640 6480464 cobaltous chloride results in decreased expression of MYO5C mRNA CTD PMID:19376846 Myo5c Rat copper(II) sulfate decreases expression ISO RGD:1320640 6480464 Copper Sulfate results in decreased expression of MYO5C mRNA CTD PMID:19549813 Myo5c Rat CU-O LINKAGE decreases expression ISO RGD:1320640 6480464 cupric oxide results in decreased expression of MYO5C mRNA CTD PMID:22077320 Myo5c Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MYO5C mRNA CTD PMID:26577399 Myo5c Rat cyclosporin A decreases expression ISO RGD:1320640 6480464 Cyclosporine results in decreased expression of MYO5C mRNA CTD PMID:25562108 Myo5c Rat deoxynivalenol decreases expression ISO RGD:1320640 6480464 deoxynivalenol results in decreased expression of MYO5C mRNA CTD PMID:26763390 Myo5c Rat diarsenic trioxide decreases response to substance ISO RGD:1320640 6480464 MYO5C protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Myo5c Rat dinophysistoxin 1 decreases expression ISO RGD:1320640 6480464 dinophysistoxin 1 results in decreased expression of MYO5C mRNA CTD PMID:28939011 Myo5c Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MYO5C mRNA CTD PMID:21551480 Myo5c Rat dorsomorphin multiple interactions ISO RGD:1320640 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Myo5c Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of MYO5C gene CTD PMID:31011160 Myo5c Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of MYO5C mRNA CTD PMID:38314887 Myo5c Rat manganese atom multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat manganese(0) multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat manganese(II) chloride multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat methapyrilene increases methylation ISO RGD:1320640 6480464 Methapyrilene results in increased methylation of MYO5C exon CTD PMID:30157460 Myo5c Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MYO5C mRNA CTD PMID:30047161 Myo5c Rat N-nitrosodiethylamine increases expression ISO RGD:1551407 6480464 Diethylnitrosamine results in increased expression of MYO5C mRNA CTD PMID:24535843 Myo5c Rat nickel atom decreases expression ISO RGD:1320640 6480464 Nickel results in decreased expression of MYO5C mRNA CTD PMID:24768652|PMID:25583101 Myo5c Rat nickel sulfate decreases expression ISO RGD:1320640 6480464 nickel sulfate results in decreased expression of MYO5C mRNA CTD PMID:22714537 Myo5c Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MYO5C mRNA CTD PMID:33484710 Myo5c Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of MYO5C mRNA CTD PMID:25729387 Myo5c Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MYO5C mRNA CTD PMID:25729387 Myo5c Rat paracetamol decreases expression ISO RGD:1320640 6480464 Acetaminophen results in decreased expression of MYO5C mRNA CTD PMID:21420995 Myo5c Rat perfluorohexanesulfonic acid decreases expression ISO RGD:1551407 6480464 perfluorohexanesulfonic acid results in decreased expression of MYO5C mRNA CTD PMID:37995155 Myo5c Rat phenol red multiple interactions ISO RGD:1320640 6480464 [Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of MYO5C protein CTD PMID:31629898 Myo5c Rat phenylmercury acetate increases expression ISO RGD:1320640 6480464 Phenylmercuric Acetate results in increased expression of MYO5C mRNA CTD PMID:26272509 Myo5c Rat phenylmercury acetate multiple interactions ISO RGD:1320640 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Myo5c Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of MYO5C mRNA CTD PMID:30047161 Myo5c Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of MYO5C mRNA CTD PMID:18095365 Myo5c Rat SB 431542 multiple interactions ISO RGD:1320640 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Myo5c Rat silicon dioxide decreases expression ISO RGD:1320640 6480464 Silicon Dioxide results in decreased expression of MYO5C mRNA CTD PMID:25351596 Myo5c Rat sodium arsenite decreases expression ISO RGD:1320640 6480464 sodium arsenite results in decreased expression of MYO5C mRNA CTD PMID:38568856 Myo5c Rat sodium arsenite multiple interactions ISO RGD:1320640 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Myo5c Rat sotorasib multiple interactions ISO RGD:1320640 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MYO5C mRNA CTD PMID:36139627 Myo5c Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MYO5C mRNA CTD PMID:30047161 Myo5c Rat tert-butyl hydroperoxide decreases expression ISO RGD:1320640 6480464 tert-Butylhydroperoxide results in decreased expression of MYO5C mRNA CTD PMID:15336504 Myo5c Rat thiram decreases expression ISO RGD:1320640 6480464 Thiram results in decreased expression of MYO5C mRNA CTD PMID:38568856 Myo5c Rat titanium dioxide decreases methylation ISO RGD:1551407 6480464 titanium dioxide results in decreased methylation of MYO5C promoter CTD PMID:35295148 Myo5c Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of MYO5C mRNA CTD PMID:25729387 Myo5c Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MYO5C mRNA CTD PMID:25729387 Myo5c Rat trametinib multiple interactions ISO RGD:1320640 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of MYO5C mRNA CTD PMID:36139627 Myo5c Rat tributylstannane increases expression ISO RGD:1551407 6480464 tributyltin results in increased expression of MYO5C mRNA CTD PMID:31939706 Myo5c Rat trichostatin A increases expression ISO RGD:1320640 6480464 trichostatin A results in increased expression of MYO5C mRNA CTD PMID:24935251 Myo5c Rat triphenyl phosphate affects expression ISO RGD:1320640 6480464 triphenyl phosphate affects the expression of MYO5C mRNA CTD PMID:37042841 Myo5c Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of MYO5C protein CTD PMID:32519852 Myo5c Rat tunicamycin increases expression ISO RGD:1320640 6480464 Tunicamycin results in increased expression of MYO5C mRNA CTD PMID:29453283 Myo5c Rat urethane decreases expression ISO RGD:1320640 6480464 Urethane results in decreased expression of MYO5C mRNA CTD PMID:28818685 Myo5c Rat valproic acid increases expression ISO RGD:1551407 6480464 Valproic Acid results in increased expression of MYO5C mRNA CTD PMID:21427059 Myo5c Rat valproic acid increases expression ISO RGD:1320640 6480464 Valproic Acid results in increased expression of MYO5C mRNA CTD PMID:23179753|PMID:24935251|PMID:26272509|PMID:27188386 Myo5c Rat valproic acid multiple interactions ISO RGD:1320640 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Myo5c Rat valproic acid affects expression ISO RGD:1320640 6480464 Valproic Acid affects the expression of MYO5C mRNA CTD PMID:25979313 Myo5c Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MYO5C mRNA CTD PMID:19015723 Myo5c Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of MYO5C gene CTD PMID:31079544
Myo5c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 84,870,031 - 84,946,996 (+) NCBI GRCr8 mRatBN7.2 8 75,989,497 - 76,066,485 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 75,989,528 - 76,066,483 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 81,496,835 - 81,574,055 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 79,761,746 - 79,838,757 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 77,596,161 - 77,673,391 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 82,171,296 - 82,248,109 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 82,171,497 - 82,247,544 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 81,771,484 - 81,851,384 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 80,101,971 - 80,119,034 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 80,057,940 - 80,136,830 (+) NCBI Celera 8 75,779,366 - 75,856,253 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
MYO5C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 52,192,322 - 52,295,804 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 52,192,322 - 52,295,804 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 52,484,519 - 52,588,001 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 50,271,811 - 50,375,262 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 50,271,811 - 50,375,144 NCBI Celera 15 29,378,960 - 29,483,015 (-) NCBI Celera Cytogenetic Map 15 q21.2 NCBI HuRef 15 29,315,479 - 29,418,640 (-) NCBI HuRef CHM1_1 15 52,602,819 - 52,705,954 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 50,000,957 - 50,104,091 (-) NCBI T2T-CHM13v2.0
Myo5c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 75,139,252 - 75,212,733 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 75,139,302 - 75,212,733 (+) Ensembl GRCm39 Ensembl GRCm38 9 75,231,969 - 75,307,485 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 75,232,020 - 75,305,451 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 75,079,821 - 75,153,258 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 75,017,923 - 75,091,360 (+) NCBI MGSCv36 mm8 Celera 9 72,390,763 - 72,464,225 (+) NCBI Celera Cytogenetic Map 9 D NCBI cM Map 9 42.3 NCBI
Myo5c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 2,546,909 - 2,612,490 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 2,543,520 - 2,612,867 (+) NCBI ChiLan1.0 ChiLan1.0
MYO5C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 41,429,040 - 41,530,708 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 45,609,547 - 45,711,119 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 31,133,566 - 31,235,074 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 49,459,741 - 49,549,746 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 49,459,741 - 49,549,752 (-) Ensembl panpan1.1 panPan2
MYO5C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 17,888,422 - 17,972,365 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 17,888,419 - 18,213,061 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 17,817,644 - 17,912,246 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 18,036,561 - 18,131,347 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 18,036,563 - 18,131,405 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 17,955,619 - 18,050,528 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 18,073,656 - 18,168,273 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 18,181,247 - 18,275,989 (-) NCBI UU_Cfam_GSD_1.0
Myo5c Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 96,155,020 - 96,246,535 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 14,003,515 - 14,094,587 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 14,003,478 - 14,094,560 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYO5C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 119,407,351 - 119,536,419 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 119,407,298 - 119,536,443 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 132,497,200 - 132,624,942 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYO5C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 31,095,461 - 31,196,514 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 31,107,036 - 31,196,049 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 110,032,427 - 110,134,967 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myo5c
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 87 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000011768 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 10450865 Bw175 Body weight QTL 175 4.1 total fat pad mass (VT:0015008) adipose tissue molecular composition measurement (CMO:0000484) 8 75311777 84531599 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 634332 Pia18 Pristane induced arthritis QTL 18 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 75311938 82925521 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat
AW535147
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 76,049,506 - 76,049,668 (+) MAPPER mRatBN7.2 Rnor_6.0 8 82,231,131 - 82,231,292 NCBI Rnor6.0 Rnor_5.0 8 81,834,406 - 81,834,567 UniSTS Rnor5.0 RGSC_v3.4 8 80,102,068 - 80,102,229 UniSTS RGSC3.4 Celera 8 75,839,305 - 75,839,466 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
49
113
91
90
59
25
59
6
216
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011768 ⟹ ENSRNOP00000011768
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 75,989,528 - 76,066,483 (+) Ensembl Rnor_6.0 Ensembl 8 82,171,497 - 82,247,544 (+) Ensembl
RefSeq Acc Id:
NM_001108167 ⟹ NP_001101637
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 84,870,043 - 84,946,996 (+) NCBI mRatBN7.2 8 75,989,528 - 76,066,485 (+) NCBI
RefSeq Acc Id:
XM_006243413 ⟹ XP_006243475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 84,870,032 - 84,946,986 (+) NCBI mRatBN7.2 8 75,989,515 - 76,066,475 (+) NCBI Rnor_6.0 8 82,171,296 - 82,248,109 (+) NCBI Rnor_5.0 8 81,771,484 - 81,851,384 (+) NCBI
Sequence:
AGTTCTGTGAGCTCGCTGATTCTTTGGTTTTCCTATGCCCTGCCCGGCGCTGTGAGGGAGCAGGAACTTGGGCGGGACCCCTGTGGGTTTCTTTCACCTGTTACCTGGGCCGGGCCAATGGCAGCGCG
hide sequence
RefSeq Acc Id:
XM_063265550 ⟹ XP_063121620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 84,895,341 - 84,946,986 (+) NCBI
RefSeq Acc Id:
XR_001839460
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 84,870,031 - 84,943,348 (+) NCBI mRatBN7.2 8 75,989,514 - 76,062,832 (+) NCBI Rnor_6.0 8 82,171,296 - 82,244,403 (+) NCBI
Sequence:
AGTTCTGTGAGCTCGCTGATTCTTTGGTTTTCCTATGCCCTGCCCGGCGCTGTGAGGGAGCAGG
hide sequence
RefSeq Acc Id:
XR_594031
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 84,870,032 - 84,939,289 (+) NCBI mRatBN7.2 8 75,989,514 - 76,058,775 (+) NCBI Rnor_6.0 8 82,171,296 - 82,240,349 (+) NCBI
Sequence:
AGTTCTGTGAGCTCGCTGATTCTTTGGTTTTCCTATGCCCTGCCCGGCGCTGTGAGGGAGCAGGAACTTGGGCGGGACCCCTGTGGGTTTCTTTCACCTGTTACCTGGGCCGGGCCAATGGCAGCGCG
hide sequence
RefSeq Acc Id:
XP_006243475 ⟸ XM_006243413
- Peptide Label:
isoform X1
- UniProtKB:
F1M111 (UniProtKB/TrEMBL), A6I1B7 (UniProtKB/TrEMBL)
- Sequence:
MAVAELYAQYNRVWIPDPEEVWKSAEIAKDYRVGDQVLRLLLEDGTELDYPVDPGSLPPLRNPDILVGENDLTALSYLHEPAVLHNLRIRFAESKLIYTYSGIILVAMNPYKQLPIYGDAIIHAYSGQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000011768 ⟸ ENSRNOT00000011768
RefSeq Acc Id:
NP_001101637 ⟸ NM_001108167
- UniProtKB:
A6I1B7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121620 ⟸ XM_063265550
- Peptide Label:
isoform X2
RGD ID: 13696134 Promoter ID: EPDNEW_R6651 Type: single initiation site Name: Myo5c_1 Description: myosin VC SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 82,171,515 - 82,171,575 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Myo5c
myosin VC
Myo5c_predicted
myosin VC (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Myo5c_predicted
myosin VC (predicted)
Symbol and Name status set to approved
70820 APPROVED
