Symbol:
Nthl1
Name:
nth-like DNA glycosylase 1
RGD ID:
1309289
Description:
Predicted to enable DNA binding activity and catalytic activity, acting on DNA. Predicted to be involved in base-excision repair, AP site formation and nucleotide-excision repair. Predicted to be located in mitochondrion. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in familial adenomatous polyposis 3. Orthologous to human NTHL1 (nth like DNA glycosylase 1); PARTICIPATES IN base excision repair pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
endonuclease III-like protein 1; nth (endonuclease III)-like 1 (E.coli); nth endonuclease III-like 1; Nth1; thymine glycol DNA glycosylase/AP lyase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NTHL1 (nth like DNA glycosylase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nthl1 (nth (endonuclease III)-like 1 (E.coli)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nthl1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NTHL1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NTHL1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nthl1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NTHL1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NTHL1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nthl1 (nth like DNA glycosylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GABRB2 (gamma-aminobutyric acid type A receptor subunit beta2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
NTHL1 (nth like DNA glycosylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nthl1 (nth (endonuclease III)-like 1 (E.coli))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nthl1 (nth-like DNA glycosylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NTG1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9272
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nth-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NTG2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nthl1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,160,334 - 14,166,502 (+) NCBI GRCr8 mRatBN7.2 10 13,655,791 - 13,661,958 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,655,785 - 13,661,957 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,402,559 - 18,408,752 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 17,891,405 - 17,897,598 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,390,604 - 13,396,797 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 13,996,660 - 14,002,827 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 13,996,645 - 14,002,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 13,813,645 - 13,819,807 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 13,883,284 - 13,889,790 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 13,883,284 - 13,889,789 (+) NCBI Celera 10 13,335,808 - 13,342,040 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nthl1 Rat 1,2-dimethylhydrazine increases expression ISO Nthl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of NTHL1 mRNA CTD PMID:22206623 Nthl1 Rat 17alpha-ethynylestradiol affects expression ISO Nthl1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of NTHL1 mRNA CTD PMID:17555576 Nthl1 Rat 17alpha-ethynylestradiol multiple interactions ISO Nthl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NTHL1 mRNA CTD PMID:17942748 Nthl1 Rat 17beta-estradiol affects expression ISO Nthl1 (Mus musculus) 6480464 Estradiol affects the expression of NTHL1 mRNA CTD PMID:16684588 Nthl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO NTHL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NTHL1 mRNA CTD PMID:19684285 Nthl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NTHL1 mRNA CTD PMID:33387578 Nthl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nthl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NTHL1 mRNA CTD PMID:21570461 Nthl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NTHL1 mRNA CTD PMID:21215274 Nthl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Nthl1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NTHL1 mRNA CTD PMID:17942748 Nthl1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NTHL1 mRNA CTD PMID:21346803 Nthl1 Rat 2-methylcholine affects expression ISO NTHL1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of NTHL1 mRNA CTD PMID:21179406 Nthl1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NTHL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NTHL1 mRNA CTD PMID:28628672 Nthl1 Rat acrolein multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NTHL1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of NTHL1 mRNA CTD PMID:32699268 Nthl1 Rat acrylamide decreases expression ISO NTHL1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of NTHL1 mRNA CTD PMID:32763439 Nthl1 Rat actinomycin D decreases expression ISO NTHL1 (Homo sapiens) 6480464 Dactinomycin results in decreased expression of NTHL1 mRNA CTD PMID:21527772 Nthl1 Rat aflatoxin B1 decreases expression ISO NTHL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of NTHL1 mRNA CTD PMID:22100608 Nthl1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of NTHL1 mRNA CTD PMID:33354967 Nthl1 Rat all-trans-retinoic acid decreases expression ISO NTHL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NTHL1 mRNA CTD PMID:16140955 more ... Nthl1 Rat alpha-pinene multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NTHL1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of NTHL1 mRNA CTD PMID:32699268 Nthl1 Rat aniline increases expression EXP 6480464 aniline results in increased expression of NTHL1 mRNA CTD PMID:23352893 Nthl1 Rat aniline multiple interactions EXP 6480464 aniline results in increased expression of and results in increased activity of NTHL1 protein CTD PMID:23352893 Nthl1 Rat antirheumatic drug increases expression ISO NTHL1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of NTHL1 mRNA CTD PMID:24449571 Nthl1 Rat arsenous acid increases expression ISO Nthl1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of NTHL1 mRNA CTD PMID:35676786 Nthl1 Rat benzo[a]pyrene increases expression ISO Nthl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NTHL1 mRNA CTD PMID:22228805 Nthl1 Rat benzo[a]pyrene affects methylation ISO NTHL1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NTHL1 3' UTR and Benzo(a)pyrene affects the methylation of NTHL1 intron CTD PMID:27901495 and PMID:30157460 Nthl1 Rat benzo[e]pyrene decreases methylation ISO NTHL1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of NTHL1 intron CTD PMID:30157460 Nthl1 Rat bezafibrate increases expression ISO Nthl1 (Mus musculus) 6480464 Bezafibrate results in increased expression of NTHL1 mRNA CTD PMID:15447978 Nthl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO NTHL1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of NTHL1 mRNA CTD PMID:33120273 Nthl1 Rat bisphenol A multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NTHL1 gene more ... CTD PMID:28628672 more ... Nthl1 Rat bisphenol A decreases expression ISO Nthl1 (Mus musculus) 6480464 bisphenol A results in decreased expression of NTHL1 mRNA CTD PMID:36633214 Nthl1 Rat bisphenol A decreases methylation ISO NTHL1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NTHL1 gene CTD PMID:31601247 Nthl1 Rat bisphenol A decreases expression ISO NTHL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NTHL1 mRNA CTD PMID:33670352 and PMID:36633214 Nthl1 Rat bisphenol A multiple interactions ISO Nthl1 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NTHL1 mRNA] CTD PMID:36633214 Nthl1 Rat bisphenol F multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NTHL1 mRNA CTD PMID:28628672 Nthl1 Rat cadmium dichloride multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of NTHL1 mRNA CTD PMID:12634122 Nthl1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of NTHL1 promoter CTD PMID:22457795 Nthl1 Rat cisplatin multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of NTHL1 mRNA and Folic Acid affects the reaction [Cisplatin affects the expression of NTHL1 mRNA] CTD PMID:16898872 and PMID:27392435 Nthl1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of NTHL1 mRNA CTD PMID:24386269 Nthl1 Rat cobalt dichloride decreases expression ISO NTHL1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NTHL1 mRNA CTD PMID:19320972 and PMID:19376846 Nthl1 Rat copper atom multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NTHL1 mRNA CTD PMID:20971185 Nthl1 Rat copper(0) multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NTHL1 mRNA CTD PMID:20971185 Nthl1 Rat copper(II) sulfate decreases expression ISO NTHL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NTHL1 mRNA CTD PMID:19549813 Nthl1 Rat coumarin increases phosphorylation ISO NTHL1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of NTHL1 protein CTD PMID:35688186 Nthl1 Rat cyclosporin A decreases expression ISO NTHL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NTHL1 mRNA CTD PMID:20106945 and PMID:25562108 Nthl1 Rat dexamethasone multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NTHL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NTHL1 mRNA CTD PMID:28628672 Nthl1 Rat diarsenic trioxide increases expression ISO Nthl1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of NTHL1 mRNA CTD PMID:35676786 Nthl1 Rat Dibutyl phosphate affects expression ISO NTHL1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NTHL1 mRNA CTD PMID:37042841 Nthl1 Rat dibutyl phthalate decreases expression ISO Nthl1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NTHL1 mRNA CTD PMID:21266533 Nthl1 Rat dibutyl phthalate increases expression ISO NTHL1 (Homo sapiens) 6480464 Dibutyl Phthalate results in increased expression of NTHL1 mRNA CTD PMID:33120273 Nthl1 Rat dichromium trioxide multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of NTHL1 mRNA CTD PMID:12634122 Nthl1 Rat doxorubicin multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [TP53 protein affects the susceptibility to Doxorubicin] which affects the expression of NTHL1 mRNA CTD PMID:36634904 Nthl1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NTHL1 mRNA CTD PMID:29391264 Nthl1 Rat ethyl methanesulfonate decreases expression ISO NTHL1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NTHL1 mRNA CTD PMID:23649840 Nthl1 Rat fenthion decreases expression ISO Nthl1 (Mus musculus) 6480464 Fenthion results in decreased expression of NTHL1 mRNA CTD PMID:34813904 Nthl1 Rat flutamide increases expression ISO Nthl1 (Mus musculus) 6480464 Flutamide results in increased expression of NTHL1 mRNA CTD PMID:19442681 Nthl1 Rat folic acid multiple interactions ISO NTHL1 (Homo sapiens) 6480464 Folic Acid affects the reaction [Cisplatin affects the expression of NTHL1 mRNA] CTD PMID:16898872 Nthl1 Rat formaldehyde decreases expression ISO NTHL1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NTHL1 mRNA CTD PMID:23649840 Nthl1 Rat FR900359 decreases phosphorylation ISO NTHL1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of NTHL1 protein CTD PMID:37730182 Nthl1 Rat fulvestrant multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NTHL1 gene CTD PMID:31601247 Nthl1 Rat indometacin multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of NTHL1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of NTHL1 mRNA CTD PMID:28628672 Nthl1 Rat lead diacetate multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of NTHL1 mRNA CTD PMID:12634122 Nthl1 Rat melatonin multiple interactions ISO NTHL1 (Homo sapiens) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NTHL1 mRNA] CTD PMID:36633214 Nthl1 Rat melatonin multiple interactions ISO Nthl1 (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of NTHL1 mRNA] CTD PMID:36633214 Nthl1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of NTHL1 mRNA CTD PMID:19564919 Nthl1 Rat methapyrilene decreases methylation ISO NTHL1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of NTHL1 intron CTD PMID:30157460 Nthl1 Rat methyl methanesulfonate decreases expression ISO NTHL1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NTHL1 mRNA CTD PMID:21527772 and PMID:23649840 Nthl1 Rat miconazole increases expression EXP 6480464 Miconazole results in increased expression of NTHL1 mRNA CTD PMID:22262564 Nthl1 Rat mono(2-ethylhexyl) phthalate increases expression ISO NTHL1 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of NTHL1 mRNA CTD PMID:33120273 Nthl1 Rat N-acetyl-L-cysteine multiple interactions ISO Nthl1 (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Tobacco Smoke Pollution results in increased expression of NTHL1 mRNA] CTD PMID:16137721 Nthl1 Rat ozone multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of NTHL1 mRNA more ... CTD PMID:32699268 Nthl1 Rat paracetamol affects expression ISO Nthl1 (Mus musculus) 6480464 Acetaminophen affects the expression of NTHL1 mRNA CTD PMID:17562736 Nthl1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NTHL1 mRNA CTD PMID:33387578 Nthl1 Rat paracetamol decreases expression ISO NTHL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NTHL1 mRNA CTD PMID:25704631 and PMID:29067470 Nthl1 Rat pirinixic acid multiple interactions ISO Nthl1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NTHL1 mRNA CTD PMID:19710929 Nthl1 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of NTHL1 mRNA CTD PMID:33775663 Nthl1 Rat sodium arsenite multiple interactions ISO NTHL1 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of NTHL1 mRNA CTD PMID:12634122 Nthl1 Rat sodium arsenite increases expression ISO NTHL1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NTHL1 mRNA CTD PMID:12634122 and PMID:34032870 Nthl1 Rat sodium arsenite decreases expression ISO NTHL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NTHL1 mRNA CTD PMID:21776218 and PMID:38568856 Nthl1 Rat sodium dichromate increases expression ISO Nthl1 (Mus musculus) 6480464 sodium bichromate results in increased expression of NTHL1 mRNA CTD PMID:22155349 Nthl1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of NTHL1 mRNA CTD PMID:19281266 Nthl1 Rat temozolomide increases expression ISO NTHL1 (Homo sapiens) 6480464 Temozolomide results in increased expression of NTHL1 mRNA CTD PMID:31758290 Nthl1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NTHL1 mRNA CTD PMID:34492290 Nthl1 Rat thiram decreases expression ISO NTHL1 (Homo sapiens) 6480464 Thiram results in decreased expression of NTHL1 mRNA CTD PMID:38568856 Nthl1 Rat titanium dioxide decreases methylation ISO Nthl1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NTHL1 gene and titanium dioxide results in decreased methylation of NTHL1 promoter alternative form CTD PMID:35295148 Nthl1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NTHL1 mRNA CTD PMID:33387578 Nthl1 Rat urethane decreases expression ISO NTHL1 (Homo sapiens) 6480464 Urethane results in decreased expression of NTHL1 mRNA CTD PMID:28818685 Nthl1 Rat valproic acid increases methylation ISO NTHL1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NTHL1 gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) acrolein (ISO) acrylamide (ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aniline (EXP) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichromium trioxide (ISO) doxorubicin (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) fenthion (ISO) flutamide (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) indometacin (ISO) lead diacetate (ISO) melatonin (ISO) methamphetamine (EXP) methapyrilene (ISO) methyl methanesulfonate (ISO) miconazole (EXP) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) ozone (ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) resveratrol (EXP) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) temozolomide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) urethane (ISO) valproic acid (ISO)
Nthl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,160,334 - 14,166,502 (+) NCBI GRCr8 mRatBN7.2 10 13,655,791 - 13,661,958 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,655,785 - 13,661,957 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,402,559 - 18,408,752 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 17,891,405 - 17,897,598 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,390,604 - 13,396,797 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 13,996,660 - 14,002,827 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 13,996,645 - 14,002,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 13,813,645 - 13,819,807 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 13,883,284 - 13,889,790 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 13,883,284 - 13,889,789 (+) NCBI Celera 10 13,335,808 - 13,342,040 (+) NCBI Celera Cytogenetic Map 10 q12 NCBI
NTHL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 2,039,820 - 2,047,834 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 2,039,815 - 2,047,866 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 2,089,821 - 2,097,835 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 2,029,817 - 2,037,868 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 2,029,816 - 2,037,868 NCBI Celera 16 2,301,923 - 2,309,974 (-) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 2,014,043 - 2,022,132 (-) NCBI HuRef CHM1_1 16 2,089,796 - 2,097,842 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 2,059,629 - 2,067,643 (-) NCBI T2T-CHM13v2.0
Nthl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 24,851,656 - 24,857,812 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 24,851,654 - 24,857,811 (+) Ensembl GRCm39 Ensembl GRCm38 17 24,632,680 - 24,638,838 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,632,680 - 24,638,837 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 24,769,627 - 24,775,783 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,360,310 - 24,366,437 (+) NCBI MGSCv36 mm8 Celera 17 25,155,083 - 25,161,227 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.42 NCBI
Nthl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 15,217,019 - 15,223,272 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 15,210,799 - 15,223,272 (+) NCBI ChiLan1.0 ChiLan1.0
NTHL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 2,298,565 - 2,306,762 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 6,080,263 - 6,088,450 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 655,433 - 663,521 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 2,127,858 - 2,135,656 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 2,127,858 - 2,135,656 (-) Ensembl panpan1.1 panPan2
NTHL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 38,899,144 - 38,904,637 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 38,899,126 - 38,905,622 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,137,884 - 40,143,376 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,207,235 - 39,212,727 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 39,207,226 - 39,212,603 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 38,892,037 - 38,897,529 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 38,864,355 - 38,869,847 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,343,154 - 39,348,649 (+) NCBI UU_Cfam_GSD_1.0
Nthl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 104,709,140 - 104,716,032 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936694 1,993,443 - 2,000,333 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936694 1,993,443 - 2,000,323 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NTHL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 39,935,475 - 39,941,712 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 39,935,619 - 39,941,718 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 42,239,826 - 42,245,913 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NTHL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,936,415 - 1,946,468 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,936,524 - 1,946,434 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,119,815 - 29,128,253 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nthl1
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0
Predicted Target Of
Count of predictions: 42 Count of miRNA genes: 41 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000016490 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
RH142233
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 13,655,341 - 13,655,514 (+) MAPPER mRatBN7.2 Rnor_6.0 10 13,996,211 - 13,996,383 NCBI Rnor6.0 Rnor_5.0 10 13,813,196 - 13,813,368 UniSTS Rnor5.0 RGSC_v3.4 10 13,882,835 - 13,883,007 UniSTS RGSC3.4 Celera 10 13,335,359 - 13,335,531 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016490 ⟹ ENSRNOP00000016490
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,655,785 - 13,661,957 (+) Ensembl Rnor_6.0 Ensembl 10 13,996,645 - 14,002,910 (+) Ensembl
RefSeq Acc Id:
NM_001105728 ⟹ NP_001099198
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,160,334 - 14,166,502 (+) NCBI mRatBN7.2 10 13,655,791 - 13,661,958 (+) NCBI Rnor_6.0 10 13,996,660 - 14,002,827 (+) NCBI Rnor_5.0 10 13,813,645 - 13,819,807 (+) NCBI RGSC_v3.4 10 13,883,284 - 13,889,790 (+) RGD Celera 10 13,335,808 - 13,342,040 (+) RGD
Sequence:
CCGCGTGCACGTTGAGCAAGTGATGGACCCGCGGGACCGCCCGGAGGTGTAGTTTCCAGCCCAGGCATGAACTCGGGGTTGCGGATAGTGACTCGCAGTCGGAGCCGCGCGACTAGGATCGCGTCGGA
hide sequence
RefSeq Acc Id:
NP_001099198 ⟸ NM_001105728
- UniProtKB:
D4A4E8 (UniProtKB/TrEMBL), A6HCU4 (UniProtKB/TrEMBL)
- Sequence:
MNSGLRIVTRSRSRATRIASEGCREELAPRETAAEGRKSHKPVRRPRKKQKVHVAYEVANGEEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEQCYDITAPPKVRRYQVLLSLMLSS
hide sequence
Ensembl Acc Id:
ENSRNOP00000016490 ⟸ ENSRNOT00000016490
RGD ID: 13697017 Promoter ID: EPDNEW_R7542 Type: multiple initiation site Name: Nthl1_1 Description: nth-like DNA glycosylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 13,996,656 - 13,996,716 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-01
Nthl1
nth-like DNA glycosylase 1
Nthl1
nth (endonuclease III)-like 1 (E.coli)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Nthl1
nth (endonuclease III)-like 1 (E.coli)
Nthl1_predicted
nth (endonuclease III)-like 1 (E.coli) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Nthl1_predicted
nth (endonuclease III)-like 1 (E.coli) (predicted)
thymine glycol DNA glycosylase/AP lyase (predicted)
Name updated
1299863 APPROVED
2005-01-12
Nthl1_predicted
thymine glycol DNA glycosylase/AP lyase (predicted)
Symbol and Name status set to approved
70820 APPROVED
