Tcim (transcriptional and immune response regulator)

Gene: Tcim (transcriptional and immune response regulator) Rattus norvegicus

Analyze

Symbol:

Tcim

Name:

transcriptional and immune response regulator

RGD ID:

6499724

Description:

Predicted to enable Notch binding activity. Predicted to be involved in several processes, including endothelial cell activation involved in immune response; regulation of cell cycle G1/S phase transition; and regulation of signal transduction. Predicted to act upstream of or within regulation of hemopoiesis. Predicted to be located in cytosol; nuclear lumen; and plasma membrane. Orthologous to human TCIM (transcriptional and immune response regulator); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC684871; LOC100910163; LOC684871; similar to Protein C8orf4 (Thyroid cancer protein 1) (TC-1); uncharacterized LOC100910163; uncharacterized protein LOC684871

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	74,298,344 - 74,299,637 (+)	NCBI		GRCr8
mRatBN7.2	16	67,595,762 - 67,597,055 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	67,593,410 - 67,597,581 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	72,872,855 - 72,874,148 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	76,278,586 - 76,279,879 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	71,527,785 - 71,529,078 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	72,388,842 - 72,390,135 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,401,887 - 72,403,179 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,388,880 - 72,389,200 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	72,046,896 - 72,048,224 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	16	65,493,820 - 65,495,113 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',5-triiodo-L-thyronine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carmustine (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

leflunomide (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

niclosamide (ISO)

nitrofen (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

quercetin (ISO)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to heat (ISO)

endothelial cell activation involved in immune response (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of Notch signaling pathway (ISO)

positive regulation of non-canonical NF-kappaB signal transduction (ISO)

positive regulation of protein kinase A signaling (ISO)

regulation of cell cycle G1/S phase transition (ISO)

regulation of hemopoiesis (ISO)

Cellular Component

cytoplasm (ISO)

cytosol (ISO)

nuclear speck (ISO)

nucleolus (ISO)

nucleoplasm (ISO)

nucleus (ISO)

plasma membrane (ISO)

Molecular Function

Notch binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15087392	PMID:16424001	PMID:17603013	PMID:18959821	PMID:19684084	PMID:24937306	PMID:25985737

Genomics

Comparative Map Data

Tcim
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	74,298,344 - 74,299,637 (+)	NCBI		GRCr8
mRatBN7.2	16	67,595,762 - 67,597,055 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	67,593,410 - 67,597,581 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	72,872,855 - 72,874,148 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	76,278,586 - 76,279,879 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	71,527,785 - 71,529,078 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	72,388,842 - 72,390,135 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,401,887 - 72,403,179 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	16	72,388,880 - 72,389,200 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	72,046,896 - 72,048,224 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	16	65,493,820 - 65,495,113 (+)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

TCIM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	40,153,482 - 40,155,310 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	40,153,482 - 40,155,310 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	40,011,001 - 40,012,829 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	40,130,146 - 40,131,978 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	40,130,143 - 40,131,599	NCBI
Celera	8	38,962,805 - 38,964,636 (+)	NCBI		Celera
Cytogenetic Map	8	p11.21	NCBI
HuRef	8	38,544,322 - 38,546,161 (+)	NCBI		HuRef
CHM1_1	8	40,057,852 - 40,059,691 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	40,430,413 - 40,432,240 (+)	NCBI		T2T-CHM13v2.0

Tcim
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	24,927,188 - 24,928,962 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	24,927,196 - 24,929,000 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	24,437,172 - 24,438,946 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	24,437,180 - 24,438,984 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	25,548,088 - 25,549,418 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	25,903,161 - 25,904,491 (-)	NCBI		MGSCv36	mm8
Celera	8	25,921,731 - 25,923,061 (-)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	12.47	NCBI

Tcim
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955536	2,786,482 - 2,786,799 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955536	2,786,384 - 2,786,988 (-)	NCBI	ChiLan1.0	ChiLan1.0

TCIM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	58,608,882 - 58,610,232 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	34,325,847 - 34,327,196 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	39,347,441 - 39,348,795 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	36,854,973 - 36,856,432 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	36,855,045 - 36,855,365 (+)	Ensembl	panpan1.1		panPan2

TCIM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	25,212,117 - 25,213,600 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	25,213,023 - 25,213,343 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	25,715,591 - 25,717,059 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	27,041,127 - 27,042,595 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	27,041,131 - 27,042,404 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	25,330,797 - 25,332,265 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	25,892,991 - 25,894,459 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	25,945,057 - 25,946,525 (-)	NCBI		UU_Cfam_GSD_1.0

Tcim
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	48,421,331 - 48,422,800 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936843	486,387 - 486,707 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936843	485,453 - 486,895 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TCIM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	9,441,766 - 9,442,086 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	9,441,488 - 9,443,053 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TCIM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	38,146,171 - 38,147,526 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	38,146,241 - 38,146,561 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	3,720,135 - 3,721,605 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tcim
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624780	3,515,018 - 3,515,335 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624780	3,514,082 - 3,515,411 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tcim
4 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

Markers in Region

RH140491

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	67,596,809 - 67,596,951 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	72,389,890 - 72,390,031	NCBI	Rnor6.0
Rnor_6.0	16	72,402,935 - 72,403,076	NCBI	Rnor6.0
Rnor_5.0	16	72,047,979 - 72,048,120	UniSTS	Rnor5.0
Rnor_5.0	16	72,034,844 - 72,034,985	UniSTS	Rnor5.0
Celera	16	65,494,868 - 65,495,009	UniSTS
RH 3.4 Map	16	647.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	21	25	23	8	23	1	1		35	27	11	1
Low		22	32	18	11	18	7	10	74		10		7
Below cutoff											4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001115043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003751622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158773	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000072459 ⟹ ENSRNOP00000065387

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	72,388,880 - 72,389,200 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000074449 ⟹ ENSRNOP00000066938

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	67,593,410 - 67,597,581 (+)	Ensembl
Rnor_6.0 Ensembl	16	72,401,887 - 72,403,179 (+)	Ensembl

RefSeq Acc Id:

NM_001115043 ⟹ NP_001108515

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	74,298,344 - 74,299,637 (+)	NCBI
mRatBN7.2	16	67,595,762 - 67,597,055 (+)	NCBI

Sequence:

show sequence

TGGAAGTGCCCAAGCTGAGCTGTGAAAGACCCACATCGATGAAAGCAAAACCAAGCCACCCAGC
CACCAGCATGTCCACTTCTCTTCGAGTAAGCCCGTCCATCCACGGCTACCACTTCGACACAGCT
GCTCGCAAGAAAGCTGTGGGTAACATCTTTGAAAACATAGACCAGGAGTCCCTGCAGAGGCTCT
TCAGGAACTCGGGAGACAAGAAGGCAGAGGAGCGGGCCAAGATCATTTTCGCCATCGACCAAGA
TTTGGAGGAGAAAACTCGAGCCCTCATGGCCCTGAAGAAGAGGACAAAAGACAAGCTTCTCCAG
TTCCTCAAACTGCGGAAATACTCCATCAAGGTACACTGAGCACAGCAGGATGGCTAAGGAGCTT
ATCCACCAATGAACCTTTAAAGACCCAGTGAGCCTGCCAGTCTTGGCAGGGGCAGTGTCCCGCA
CAAAGGCTTGAGAGCTTCTCCCGACAGGACTCCGAGGATGGAAGGGACATACCTCACCAGCTAC
ACAGACTCCCAACTCCTTACAGCCCTGAGCTGTCCCACTGGGAGCAAAGTGCCTTCAGCAGGTG
TTGAGAACTCTCGCAGCAGGAAAGGAGCAACACAGCCTGAGAGAATGGAGGCACGGACCAGAAC
TTGCAGAACATGGCATTTGTGGGGACTGAGTGCACGCATCCAGGGTCCTGGGAAAGGCCCTAAA
ACTAAACTCAAACCTAACTTGGTTTTTGTTCTTGTTGTTTGGTTTGTTATTTTGTTTTCTTTCT
TTTTGAAAAATATCGAAGTGGGTAAGGAGAGGGAGGAAAGAGAAGGAATATGAACCGTAAATGG
TTTACTGAAGTTTTGCTTTTTTGTTTTTTAACCCGAATGTCTTAAAATGTGGCTAAACCTCCGT
GCTGTTTATGGGGTCAAGATTTTTACAGATCAGTAATTGACTGCTTGCATTTCATACAATGCCT
AAGACAGTGCGCCCCCTGGTGTTAAAGTCAAAGAACTGGATGCCTTGCCCAGCATGGTGGTCGT
CTATGGATTTGTACACATTCCAAAATGGTTTGCCCAAAGTTGAAAGAATGGGGCCCTTCATAAA
TCTGAAGGACTGTGAACGATTTTCTAATGTTTTTTTAAACTTTCTGGCTAATGCTAAAATATAA
TCTAATTAAATGTCCTACAGACACCGTAGCGAGCATTAGGATATGAATATGAGAGATTGTTTAG
AAGGATGCTGTGGTATTTTTTATATAATTTATTATACATTGTAAGTGATACATAGCCTAATAAA
TTATTATCAACTTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001108515	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58774	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

ENSRNOP00000066938 ⟸ ENSRNOT00000074449

RefSeq Acc Id:

ENSRNOP00000065387 ⟸ ENSRNOT00000072459

RefSeq Acc Id:	NP_001108515 ⟸ NM_001115043
- UniProtKB:	B0BND1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKAKPSHPATSMSTSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERA KIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH hide sequence

Protein Domains

Arginine vasopressin-induced protein

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BND1-F1-model_v2	AlphaFold	B0BND1	1-106	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:6499724	AgrOrtholog
Ensembl Genes	ENSRNOG00000047977	Ensembl
	ENSRNOG00000049811	Ensembl
IMAGE_CLONE	IMAGE:7130655	IMAGE-MGC_LOAD
InterPro	Arg_vasopressin-induced_prot_1	UniProtKB/TrEMBL
	Tcim	UniProtKB/TrEMBL
KEGG Report	rno:684871	UniProtKB/TrEMBL
MGC_CLONE	MGC:188085	IMAGE-MGC_LOAD
NCBI Gene	Tcim	ENTREZGENE
PANTHER	PTHR32358	UniProtKB/TrEMBL
	TRANSCRIPTIONAL AND IMMUNE RESPONSE REGULATOR	UniProtKB/TrEMBL
Pfam	TC1	UniProtKB/TrEMBL
PhenoGen	Tcim	PhenoGen
RatGTEx	ENSRNOG00000047977	RatGTEx
	ENSRNOG00000049811	RatGTEx
UniProt	B0BND1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Tcim	transcriptional and immune response regulator	LOC684871	similar to Protein C8orf4 (Thyroid cancer protein 1) (TC-1)	Data merged from RGD:1585525	737654	PROVISIONAL
2018-09-06	Tcim	transcriptional and immune response regulator	LOC100910163	uncharacterized LOC100910163	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100910163	uncharacterized LOC100910163			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC684871	similar to Protein C8orf4 (Thyroid cancer protein 1) (TC-1)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD