Symbol:
Basp1
Name:
brain abundant, membrane attached signal protein 1
RGD ID:
621491
Description:
Predicted to enable several functions, including calmodulin binding activity; transcription cis-regulatory region binding activity; and transcription corepressor activity. Predicted to be involved in several processes, including podocyte differentiation; protein homooligomerization; and substantia nigra development. Located in cytoplasm. Orthologous to human BASP1 (brain abundant membrane attached signal protein 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
22 kDa neuronal tissue-enriched acidic protein; brain acid soluble protein 1; brain acidic membrane protein; hypothetical protein LOC100364588; LOC100364588; NAP22; neuronal axonal membrane protein NAP-22
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 77,546,628 - 77,594,297 (-) NCBI GRCr8 mRatBN7.2 2 75,816,130 - 75,863,801 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 75,816,122 - 75,864,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 82,949,754 - 82,997,875 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 81,071,464 - 81,119,589 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 76,077,273 - 76,124,106 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 77,586,424 - 77,632,626 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 77,586,424 - 77,632,628 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 97,311,340 - 97,358,165 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 76,877,616 - 76,927,721 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 76,805,848 - 76,855,954 (-) NCBI Celera 2 71,538,327 - 71,584,897 (-) NCBI Celera Cytogenetic Map 2 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Basp1 Rat (+)-lariciresinol decreases expression ISO RGD:1347703 6480464 lariciresinol results in decreased expression of BASP1 protein CTD PMID:27417256 Basp1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BASP1 mRNA] CTD PMID:31150632 Basp1 Rat (-)-demecolcine increases expression ISO RGD:1347703 6480464 Demecolcine results in increased expression of BASP1 mRNA CTD PMID:23649840 Basp1 Rat (-)-lariciresinol decreases expression ISO RGD:1347703 6480464 lariciresinol results in decreased expression of BASP1 protein CTD PMID:27417256 Basp1 Rat (2,4,5-trichlorophenoxy)acetic acid increases expression ISO RGD:733369 6480464 2,4,5-Trichlorophenoxyacetic Acid results in increased expression of BASP1 mRNA CTD PMID:18579281 Basp1 Rat 1,1-dichloroethene increases expression ISO RGD:733369 6480464 vinylidene chloride results in increased expression of BASP1 mRNA CTD PMID:26682919 Basp1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of BASP1 mRNA CTD PMID:30723492 Basp1 Rat 17beta-estradiol decreases expression ISO RGD:1347703 6480464 Estradiol results in decreased expression of BASP1 mRNA CTD PMID:16474171|PMID:23019147 Basp1 Rat 17beta-estradiol multiple interactions ISO RGD:1347703 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of BASP1 mRNA CTD PMID:22217510 Basp1 Rat 17beta-estradiol decreases expression ISO RGD:733369 6480464 Estradiol results in decreased expression of BASP1 mRNA CTD PMID:39298647 Basp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BASP1 mRNA CTD PMID:22298810|PMID:34747641 Basp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:733369 6480464 Tetrachlorodibenzodioxin results in increased expression of BASP1 mRNA CTD PMID:19770486 Basp1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO RGD:733369 6480464 Trinitrobenzenesulfonic Acid results in increased expression of BASP1 mRNA CTD PMID:17982090 Basp1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:733369 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of BASP1 protein CTD PMID:18550172 Basp1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:733369 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of BASP1 mRNA CTD PMID:38648751 Basp1 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1347703 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ... CTD PMID:38598786 Basp1 Rat 2-hydroxypropanoic acid increases expression ISO RGD:1347703 6480464 Lactic Acid results in increased expression of BASP1 mRNA CTD PMID:30851411 Basp1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of BASP1 mRNA CTD PMID:30071829 Basp1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of BASP1 mRNA CTD PMID:30723492 Basp1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1347703 6480464 bisphenol S results in increased expression of BASP1 protein CTD PMID:34186270 Basp1 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:733369 6480464 bisphenol S affects the methylation of BASP1 gene CTD PMID:31683443 Basp1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:733369 6480464 Fenretinide results in increased expression of BASP1 mRNA CTD PMID:28973697 Basp1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BASP1 mRNA CTD PMID:24780913|PMID:39441382 Basp1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of BASP1 mRNA CTD PMID:12376462 Basp1 Rat 7,12-dimethyltetraphene multiple interactions ISO RGD:733369 6480464 [Dietary Fats co-treated with Dietary Sucrose co-treated with 9,10-Dimethyl-1,2-benzanthracene] results in decreased expression of BASP1 more ... CTD PMID:39910959 Basp1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of BASP1 mRNA CTD PMID:31881176 Basp1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of BASP1 mRNA CTD PMID:28959563 Basp1 Rat aflatoxin B1 decreases expression ISO RGD:733369 6480464 Aflatoxin B1 results in decreased expression of BASP1 mRNA CTD PMID:19770486 Basp1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of BASP1 mRNA CTD PMID:25378103 Basp1 Rat aflatoxin B1 increases expression ISO RGD:1347703 6480464 Aflatoxin B1 results in increased expression of BASP1 mRNA CTD PMID:27153756 Basp1 Rat all-trans-retinoic acid decreases expression ISO RGD:1347703 6480464 Tretinoin results in decreased expression of BASP1 mRNA CTD PMID:21934132|PMID:34742744 Basp1 Rat all-trans-retinoic acid increases expression ISO RGD:1347703 6480464 Tretinoin results in increased expression of BASP1 mRNA CTD PMID:33167477 Basp1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BASP1 mRNA CTD PMID:35163327 Basp1 Rat aminoglutethimide decreases expression ISO RGD:1347703 6480464 Aminoglutethimide results in decreased expression of BASP1 protein CTD PMID:26102013 Basp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BASP1 mRNA CTD PMID:16483693 Basp1 Rat aristolochic acid A increases expression ISO RGD:1347703 6480464 aristolochic acid I results in increased expression of BASP1 mRNA CTD PMID:33212167 Basp1 Rat arsane multiple interactions ISO RGD:1347703 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BASP1 more ... CTD PMID:39836092 Basp1 Rat arsenic atom multiple interactions ISO RGD:1347703 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BASP1 more ... CTD PMID:39836092 Basp1 Rat arsenous acid increases expression ISO RGD:1347703 6480464 Arsenic Trioxide results in increased expression of BASP1 mRNA CTD PMID:20458559 Basp1 Rat benzo[a]pyrene decreases expression ISO RGD:733369 6480464 Benzo(a)pyrene results in decreased expression of BASP1 mRNA CTD PMID:19770486 Basp1 Rat benzo[a]pyrene affects methylation ISO RGD:1347703 6480464 Benzo(a)pyrene affects the methylation of BASP1 5' UTR CTD PMID:27901495 Basp1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of BASP1 mRNA CTD PMID:18164116 Basp1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:733369 6480464 Diethylhexyl Phthalate results in decreased expression of BASP1 mRNA CTD PMID:33754040|PMID:34319233 Basp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BASP1 mRNA CTD PMID:25181051 Basp1 Rat bisphenol A increases expression ISO RGD:1347703 6480464 bisphenol A results in increased expression of BASP1 protein CTD PMID:34186270|PMID:37567409 Basp1 Rat bisphenol A decreases expression ISO RGD:733369 6480464 bisphenol A results in decreased expression of BASP1 mRNA CTD PMID:32156529 Basp1 Rat bisphenol A multiple interactions ISO RGD:1347703 6480464 [[ginger extract results in increased abundance of Oils, Volatile] which co-treated with bisphenol A] affects more ... CTD PMID:33376534 Basp1 Rat bisphenol A decreases expression ISO RGD:1347703 6480464 bisphenol A results in decreased expression of BASP1 mRNA CTD PMID:16474171 Basp1 Rat bisphenol AF increases expression ISO RGD:1347703 6480464 bisphenol AF results in increased expression of BASP1 protein CTD PMID:34186270 Basp1 Rat Bisphenol B increases expression ISO RGD:1347703 6480464 bisphenol B results in increased expression of BASP1 protein CTD PMID:34186270 Basp1 Rat bisphenol F increases expression ISO RGD:1347703 6480464 bisphenol F results in increased expression of BASP1 protein CTD PMID:34186270 Basp1 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of BASP1 protein CTD PMID:25933445 Basp1 Rat buta-1,3-diene decreases expression ISO RGD:733369 6480464 1,3-butadiene results in decreased expression of BASP1 mRNA CTD PMID:29038090 Basp1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of BASP1 mRNA CTD PMID:19167457 Basp1 Rat caffeine increases expression ISO RGD:1347703 6480464 Caffeine results in increased expression of BASP1 protein CTD PMID:31195006 Basp1 Rat carbamazepine affects expression ISO RGD:1347703 6480464 Carbamazepine affects the expression of BASP1 mRNA CTD PMID:25979313 Basp1 Rat carbon nanotube increases expression ISO RGD:733369 6480464 Nanotubes, Carbon analog results in increased expression of BASP1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Basp1 Rat carnosic acid decreases expression ISO RGD:733369 6480464 salvin results in decreased expression of BASP1 protein CTD PMID:35926579 Basp1 Rat casticin decreases expression ISO RGD:733369 6480464 casticin results in decreased expression of BASP1 mRNA CTD PMID:28444820 Basp1 Rat chloropicrin decreases expression ISO RGD:1347703 6480464 chloropicrin results in decreased expression of BASP1 mRNA CTD PMID:26352163 Basp1 Rat chloropicrin increases expression ISO RGD:1347703 6480464 chloropicrin results in increased expression of BASP1 mRNA CTD PMID:26352163 Basp1 Rat chlorpyrifos decreases expression ISO RGD:733369 6480464 Chlorpyrifos results in decreased expression of BASP1 mRNA CTD PMID:29156651 Basp1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of BASP1 protein CTD PMID:22023808 Basp1 Rat clobetasol decreases expression ISO RGD:733369 6480464 Clobetasol results in decreased expression of BASP1 mRNA CTD PMID:27462272 Basp1 Rat cobalt dichloride decreases expression ISO RGD:1347703 6480464 cobaltous chloride results in decreased expression of BASP1 mRNA CTD PMID:19320972 Basp1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of BASP1 mRNA CTD PMID:20187946 Basp1 Rat copper(II) sulfate increases expression ISO RGD:733369 6480464 Copper Sulfate results in increased expression of BASP1 mRNA CTD PMID:18579281 Basp1 Rat coumarin decreases phosphorylation ISO RGD:1347703 6480464 coumarin results in decreased phosphorylation of BASP1 protein CTD PMID:35688186 Basp1 Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of BASP1 mRNA CTD PMID:21865292 Basp1 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of BASP1 mRNA] CTD PMID:20032058 Basp1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of BASP1 mRNA CTD PMID:20032058 Basp1 Rat diarsenic trioxide increases expression ISO RGD:1347703 6480464 Arsenic Trioxide results in increased expression of BASP1 mRNA CTD PMID:20458559 Basp1 Rat Dibutyl phosphate affects expression ISO RGD:1347703 6480464 di-n-butylphosphoric acid affects the expression of BASP1 mRNA CTD PMID:37042841 Basp1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of BASP1 mRNA CTD PMID:24893172 Basp1 Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of BASP1 mRNA CTD PMID:22911455 Basp1 Rat dorsomorphin multiple interactions ISO RGD:1347703 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Basp1 Rat doxorubicin decreases expression ISO RGD:1347703 6480464 Doxorubicin results in decreased expression of BASP1 mRNA CTD PMID:29803840 Basp1 Rat ethanol affects expression ISO RGD:733369 6480464 Ethanol affects the expression of BASP1 mRNA CTD PMID:30319688 Basp1 Rat ethanol affects splicing ISO RGD:733369 6480464 Ethanol affects the splicing of BASP1 mRNA CTD PMID:30319688 Basp1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of BASP1 mRNA CTD PMID:30307764 Basp1 Rat formaldehyde increases expression ISO RGD:1347703 6480464 Formaldehyde results in increased expression of BASP1 mRNA CTD PMID:23649840 Basp1 Rat furfural multiple interactions ISO RGD:1347703 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Basp1 Rat genistein decreases expression ISO RGD:1347703 6480464 Genistein results in decreased expression of BASP1 mRNA CTD PMID:16474171 Basp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BASP1 mRNA CTD PMID:33387578 Basp1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of BASP1 mRNA CTD PMID:24136188 Basp1 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of BASP1 mRNA CTD PMID:24915197 Basp1 Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of BASP1 gene CTD PMID:31011160 Basp1 Rat GSK-J4 increases expression ISO RGD:1347703 6480464 GSK-J4 results in increased expression of BASP1 mRNA CTD PMID:29301935 Basp1 Rat hexadecanoic acid decreases phosphorylation ISO RGD:1347703 6480464 Palmitic Acid results in decreased phosphorylation of BASP1 protein CTD PMID:28073184 Basp1 Rat isotretinoin increases expression ISO RGD:1347703 6480464 Isotretinoin results in increased expression of BASP1 mRNA CTD PMID:20436886 Basp1 Rat lipopolysaccharide increases expression ISO RGD:733369 6480464 Lipopolysaccharides results in increased expression of BASP1 mRNA CTD PMID:27339419 Basp1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of BASP1 protein CTD PMID:37182599 Basp1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of BASP1 mRNA CTD PMID:19638242 Basp1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of BASP1 mRNA CTD PMID:18164116 Basp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BASP1 mRNA CTD PMID:25729387 Basp1 Rat paracetamol affects expression ISO RGD:733369 6480464 Acetaminophen affects the expression of BASP1 mRNA CTD PMID:17562736 Basp1 Rat paracetamol increases expression ISO RGD:1347703 6480464 Acetaminophen results in increased expression of BASP1 mRNA CTD PMID:21420995 Basp1 Rat paracetamol increases expression ISO RGD:733369 6480464 Acetaminophen results in increased expression of BASP1 mRNA CTD PMID:17585979 Basp1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of BASP1 mRNA CTD PMID:32680482 Basp1 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:733369 6480464 perfluorohexanesulfonic acid results in decreased expression of BASP1 mRNA CTD PMID:37995155 Basp1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BASP1 mRNA CTD PMID:35163327 Basp1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of BASP1 mRNA CTD PMID:12376462 Basp1 Rat pirinixic acid decreases expression ISO RGD:733369 6480464 pirinixic acid results in decreased expression of BASP1 mRNA CTD PMID:17426115 Basp1 Rat rac-lactic acid increases expression ISO RGD:1347703 6480464 Lactic Acid results in increased expression of BASP1 mRNA CTD PMID:30851411 Basp1 Rat rotenone increases expression ISO RGD:733369 6480464 Rotenone results in increased expression of BASP1 mRNA CTD PMID:32937126 Basp1 Rat SB 431542 multiple interactions ISO RGD:1347703 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of BASP1 more ... CTD PMID:27188386|PMID:37664457 Basp1 Rat silicon dioxide increases expression ISO RGD:733369 6480464 Silicon Dioxide results in increased expression of BASP1 mRNA CTD PMID:29203145 Basp1 Rat sodium arsenite decreases expression ISO RGD:1347703 6480464 sodium arsenite results in decreased expression of BASP1 protein CTD PMID:29277653|PMID:30090327 Basp1 Rat sodium arsenite increases expression ISO RGD:1347703 6480464 sodium arsenite results in increased expression of BASP1 mRNA CTD PMID:38568856 Basp1 Rat sodium arsenite multiple interactions ISO RGD:1347703 6480464 [Oligodeoxyribonucleotides, Antisense results in decreased expression of EPAS1 protein] inhibits the reaction [sodium arsenite results more ... CTD PMID:29277653|PMID:30090327|PMID:39836092 Basp1 Rat sodium chloride multiple interactions ISO RGD:1347703 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 Basp1 Rat sulforaphane increases expression ISO RGD:733369 6480464 sulforaphane results in increased expression of BASP1 mRNA CTD PMID:30529165 Basp1 Rat tebuconazole decreases expression ISO RGD:1347703 6480464 tebuconazole results in decreased expression of BASP1 mRNA CTD PMID:30458266 Basp1 Rat temozolomide decreases expression ISO RGD:1347703 6480464 Temozolomide results in decreased expression of BASP1 mRNA CTD PMID:31758290 Basp1 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of BASP1 mRNA] CTD PMID:20032058 Basp1 Rat tetrachloromethane increases expression ISO RGD:733369 6480464 Carbon Tetrachloride results in increased expression of BASP1 mRNA CTD PMID:17484886|PMID:27339419|PMID:31919559 Basp1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BASP1 mRNA] CTD PMID:31150632 Basp1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BASP1 mRNA CTD PMID:31150632 Basp1 Rat thapsigargin decreases expression ISO RGD:1347703 6480464 Thapsigargin results in decreased expression of BASP1 mRNA CTD PMID:22378314|PMID:29453283 Basp1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BASP1 mRNA CTD PMID:23411599|PMID:34492290 Basp1 Rat thiram increases expression ISO RGD:1347703 6480464 Thiram results in increased expression of BASP1 mRNA CTD PMID:38568856 Basp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BASP1 mRNA CTD PMID:25729387 Basp1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of BASP1 mRNA CTD PMID:25729387 Basp1 Rat tremolite asbestos increases expression ISO RGD:733369 6480464 tremolite results in increased expression of BASP1 mRNA CTD PMID:29279043 Basp1 Rat trichloroethene increases expression ISO RGD:733369 6480464 Trichloroethylene results in increased expression of BASP1 mRNA CTD PMID:19254012 Basp1 Rat trichostatin A multiple interactions ISO RGD:1347703 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Basp1 Rat triphenyl phosphate affects expression ISO RGD:1347703 6480464 triphenyl phosphate affects the expression of BASP1 mRNA CTD PMID:37042841 Basp1 Rat tunicamycin decreases expression ISO RGD:1347703 6480464 Tunicamycin results in decreased expression of BASP1 mRNA CTD PMID:22378314 Basp1 Rat valproic acid affects expression ISO RGD:1347703 6480464 Valproic Acid affects the expression of BASP1 mRNA CTD PMID:25979313 Basp1 Rat valproic acid increases expression ISO RGD:1347703 6480464 Valproic Acid results in increased expression of BASP1 mRNA CTD PMID:24849673 Basp1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of BASP1 mRNA CTD PMID:19015723 Basp1 Rat vincristine increases expression ISO RGD:1347703 6480464 Vincristine results in increased expression of BASP1 mRNA CTD PMID:23649840 Basp1 Rat zoledronic acid increases expression ISO RGD:1347703 6480464 zoledronic acid results in increased expression of BASP1 mRNA CTD PMID:24714768
(+)-lariciresinol (ISO) (+)-schisandrin B (EXP) (-)-demecolcine (ISO) (-)-lariciresinol (ISO) (2,4,5-trichlorophenoxy)acetic acid (ISO) 1,1-dichloroethene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP,ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aminoglutethimide (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) buta-1,3-diene (ISO) C60 fullerene (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) carnosic acid (ISO) casticin (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cisplatin (EXP) clobetasol (ISO) cobalt dichloride (ISO) cocaine (EXP) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (EXP) dexamethasone (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) fenvalerate (EXP) formaldehyde (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glycidol (EXP) glyphosate (EXP) GSK-J4 (ISO) hexadecanoic acid (ISO) isotretinoin (ISO) lipopolysaccharide (ISO) Mesaconitine (EXP) N-nitrosodiethylamine (EXP) oxaliplatin (EXP) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) PhIP (EXP) pirinixic acid (ISO) rac-lactic acid (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulforaphane (ISO) tebuconazole (ISO) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) topotecan (EXP) tremolite asbestos (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) zoledronic acid (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Motor, sensory and autonomic nerve terminals containing NAP-22 immunoreactivity in the rat muscle.
Iino S, etal., Brain Res 2004 Mar 26;1002(1-2):142-50.
3.
Localization of the Cl(-)-ATPase activity on NAP-22 enriched membrane microdomain (raft) of rat brain.
Maekawa S and Taguchi K, Neurosci Lett 2004 May 20;362(2):158-61.
4.
Purification and molecular cloning of a novel acidic calmodulin binding protein from rat brain.
Maekawa S, etal., J Biol Chem 1993 Jun 25;268(18):13703-9.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Subcellular and regional location of "brain" proteins BASP1 and MARCKS in kidney and testis.
Mosevitsky M and Silicheva I, Acta Histochem. 2011 Jan;113(1):13-8. doi: 10.1016/j.acthis.2009.07.002. Epub 2009 Aug 15.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Basp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 77,546,628 - 77,594,297 (-) NCBI GRCr8 mRatBN7.2 2 75,816,130 - 75,863,801 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 75,816,122 - 75,864,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 82,949,754 - 82,997,875 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 81,071,464 - 81,119,589 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 76,077,273 - 76,124,106 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 77,586,424 - 77,632,626 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 77,586,424 - 77,632,628 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 97,311,340 - 97,358,165 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 76,877,616 - 76,927,721 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 76,805,848 - 76,855,954 (-) NCBI Celera 2 71,538,327 - 71,584,897 (-) NCBI Celera Cytogenetic Map 2 q22 NCBI
BASP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 17,216,823 - 17,276,834 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 17,065,598 - 17,276,843 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 17,216,932 - 17,276,943 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 17,270,750 - 17,329,943 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 17,270,749 - 17,329,941 NCBI Celera 5 17,243,172 - 17,302,814 (+) NCBI Celera Cytogenetic Map 5 p15.1 NCBI HuRef 5 17,189,229 - 17,249,076 (+) NCBI HuRef CHM1_1 5 17,216,832 - 17,276,803 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 17,156,199 - 17,216,216 (+) NCBI T2T-CHM13v2.0
Basp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 25,363,363 - 25,413,850 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 25,363,363 - 25,413,850 (-) Ensembl GRCm39 Ensembl GRCm38 15 25,363,277 - 25,413,764 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 25,363,277 - 25,413,764 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 25,293,032 - 25,343,519 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 25,308,954 - 25,309,634 (-) NCBI MGSCv36 mm8 Celera 15 26,139,197 - 26,140,893 (-) NCBI Celera Cytogenetic Map 15 B1 NCBI cM Map 15 9.16 NCBI
Basp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955426 6,149,756 - 6,193,209 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955426 6,149,756 - 6,193,222 (+) NCBI ChiLan1.0 ChiLan1.0
BASP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 17,451,370 - 17,511,336 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 15,604,981 - 15,664,946 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 17,521,054 - 17,580,999 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 17,352,374 - 17,410,703 (+) NCBI panpan1.1 PanPan1.1 panPan2
BASP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 86,360,641 - 86,417,408 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 86,361,608 - 86,382,715 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 85,879,057 - 85,935,776 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 86,997,031 - 87,053,929 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 4 86,521,790 - 86,579,229 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 86,758,502 - 86,813,946 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 87,613,831 - 87,671,673 (-) NCBI UU_Cfam_GSD_1.0
Basp1
BASP1
BASP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 16,871,488 - 16,937,685 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 16,936,178 - 16,936,858 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666064 11,538,507 - 11,598,034 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Basp1
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 66 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000072233, ENSRNOT00000073915 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578777 Stresp15 Stress response QTL 15 2 0.05 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 2 59846005 104846005 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631500 Bp99 Blood pressure QTL 99 2.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 59324719 102755241 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 5684996 Bmd85 Bone mineral density QTL 85 4.7 0.024 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 2 59324377 103795077 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 5684990 Bmd82 Bone mineral density QTL 82 2.8 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 2 59324377 103795077 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 7411551 Bw131 Body weight QTL 131 29.6 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 67942638 112942638 Rat 1359034 Bp274 Blood pressure QTL 274 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 74786664 94359546 Rat 1558648 Smcn1 Smooth muscle cell number QTL 1 0.039 blood vessel smooth muscle cell quantity (VT:0010525) aorta smooth muscle cell count per unit vessel length (CMO:0001646) 2 59134147 127460910 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 2306903 Bp336 Blood pressure QTL 336 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 64366971 109366971 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1582246 Cm60 Cardiac mass QTL 60 5.8 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 57605612 76539510 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
D2Rat203
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 77,589,738 - 77,589,883 (+) Marker Load Pipeline mRatBN7.2 2 75,859,242 - 75,859,387 (+) MAPPER mRatBN7.2 Rnor_6.0 2 77,628,068 - 77,628,212 NCBI Rnor6.0 Rnor_5.0 2 97,353,607 - 97,353,751 UniSTS Rnor5.0 RGSC_v3.4 2 76,923,163 - 76,923,307 UniSTS RGSC3.4 RGSC_v3.4 2 76,923,162 - 76,923,307 RGD RGSC3.4 RGSC_v3.1 2 76,851,396 - 76,851,540 RGD Celera 2 71,580,339 - 71,580,483 UniSTS RH 3.4 Map 2 498.2 UniSTS RH 3.4 Map 2 498.2 RGD SHRSP x BN Map 2 29.7798 RGD SHRSP x BN Map 2 29.7798 UniSTS Cytogenetic Map 2 q22 UniSTS
RH134721
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 75,864,258 - 75,864,445 (+) MAPPER mRatBN7.2 Rnor_6.0 2 77,633,084 - 77,633,270 NCBI Rnor6.0 Rnor_5.0 2 97,358,623 - 97,358,809 UniSTS Rnor5.0 RGSC_v3.4 2 76,928,179 - 76,928,365 UniSTS RGSC3.4 Celera 2 71,585,355 - 71,585,541 UniSTS RH 3.4 Map 2 498.2 UniSTS Cytogenetic Map 2 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000073915 ⟹ ENSRNOP00000071894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 77,586,424 - 77,632,628 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106856 ⟹ ENSRNOP00000085289
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 75,816,122 - 75,864,043 (-) Ensembl
RefSeq Acc Id:
NM_022300 ⟹ NP_071636
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 77,547,399 - 77,594,297 (-) NCBI mRatBN7.2 2 75,816,901 - 75,863,801 (-) NCBI Rnor_6.0 2 77,586,424 - 77,632,626 (-) NCBI Rnor_5.0 2 97,311,340 - 97,358,165 (-) NCBI RGSC_v3.4 2 76,877,616 - 76,927,721 (-) RGD Celera 2 71,538,327 - 71,584,897 (-) NCBI
Sequence:
GGGGGCTGCAGCGGCGGCGGCAGTAGCGGCAGCGGCGGCGGCGGCGGCGGCAGCGCTCCAACTCGCTCCACGCTCCGGCTCCGCCGTCGAGCCGGGAGAGAGAGAGCCTTTGCTGAGCGGCCAGGCAC
hide sequence
RefSeq Acc Id:
XM_039103039 ⟹ XP_038958967
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 77,546,628 - 77,560,228 (-) NCBI mRatBN7.2 2 75,816,130 - 75,829,730 (-) NCBI
RefSeq Acc Id:
NP_071636 ⟸ NM_022300
- UniProtKB:
A0A8I6A304 (UniProtKB/TrEMBL)
- Sequence:
MGSKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTQKESEPQAAADATEVKESAEEKPKDAADGEAKAEEKEADKAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASA
hide sequence
Ensembl Acc Id:
ENSRNOP00000071894 ⟸ ENSRNOT00000073915
RefSeq Acc Id:
XP_038958967 ⟸ XM_039103039
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A304 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085289 ⟸ ENSRNOT00000106856
RGD ID: 13691199 Promoter ID: EPDNEW_R1724 Type: initiation region Name: Basp1_1 Description: brain abundant, membrane attached signal protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 77,632,608 - 77,632,668 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-04-17
Basp1
brain abundant, membrane attached signal protein 1
LOC100364588
hypothetical protein LOC100364588
Data merged from RGD:2320772
737654 PROVISIONAL
2010-05-05
LOC100364588
hypothetical protein LOC100364588
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Basp1
brain abundant, membrane attached signal protein 1
brain acidic membrane protein
Name updated
1299863 APPROVED
2002-08-07
Basp1
brain acidic membrane protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in brain
632255
gene_homology
NH2-terminal 50-amino acid sequence highly homologous to chicken CAP-23 protein
632255
gene_protein
Ca(2+)-dependent calmodulin binding
632255
