Advanced Search (OLGA)

Gene: Ctbs (chitobiase) Rattus norvegicus

Analyze

Symbol:

Ctbs

Name:

chitobiase

RGD ID:

621338

Description:

Enables chitinase activity. Involved in chitin catabolic process and oligosaccharide catabolic process. Located in lysosome. Orthologous to human CTBS (chitobiase); INTERACTS WITH 6-propyl-2-thiouracil; alpha-Zearalanol; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chitobiase, di-N-acetyl-; di-N-acetylchitobiase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTBS (chitobiase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ctbs (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ctbs (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTBS (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTBS (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ctbs (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CTBS (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CTBS (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ctbs (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ctbs (chitobiase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HESX1 (HESX homeobox 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CTBS (chitobiase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ctbs (chitobiase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ctbs (chitobiase, di-N-acetyl-)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100494478	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ctbs	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	238,000,800 - 238,015,368 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	238,000,842 - 238,015,475 (+)	Ensembl				GRCr8
mRatBN7.2	2	235,340,520 - 235,355,091 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	235,340,547 - 235,355,091 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	243,136,262 - 243,150,803 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,027,676 - 241,042,213 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,893,896 - 235,908,437 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	237,897,460 - 237,911,946 (+)	NCBI
Lyon_Normotensive	2	238,021,601 - 238,036,087 (+)	NCBI
Lyon_Hypertensive	2	237,708,534 - 237,723,020 (+)	NCBI
F344_StmMcwi	2	237,771,094 - 237,785,580 (+)	NCBI
Rnor_6.0	2	252,305,874 - 252,320,387 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,305,874 - 252,320,387 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	2	270,832,838 - 270,847,352 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	244,648,365 - 244,662,878 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	227,320,301 - 227,334,815 (+)	NCBI		Celera
RGSC_v3.1	2	244,635,104 - 244,649,618 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

clear cell renal cell carcinoma (ISO)

Thyroid Carcinoma, Nonmedullary 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

choline (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

entinostat (ISO)

epoxiconazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (EXP)

glafenine (EXP)

glycidyl methacrylate (ISO)

inulin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

ochratoxin A (ISO)

okadaic acid (ISO)

ozone (ISO)

p-toluidine (EXP)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

potassium dichromate (ISO)

resveratrol (ISO)

rotenone (ISO)

Salinomycin (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate catabolic process (IEA,ISO)

carbohydrate metabolic process (IEA)

chitin catabolic process (IBA,IDA,IEA,ISO)

oligosaccharide catabolic process (IBA,IDA)

Cellular Component

lysosome (IDA,IEA)

Molecular Function

chitin binding (IEA)

chitinase activity (IBA,IDA)

hydrolase activity, acting on glycosyl bonds (IEA,ISO,TAS)

hydrolase activity, hydrolyzing O-glycosyl compounds (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat liver chitobiase: purification, properties, and role in the lysosomal degradation of Asn-linked glycoproteins.	Aronson NN Jr, etal., Arch Biochem Biophys. 1989 Aug 1;272(2):290-300.
2.	Cloning and expression of the cDNA sequence encoding the lysosomal glycosidase di-N-acetylchitobiase.	Fisher KJ and Aronson NN Jr, J Biol Chem 1992 Sep 25;267(27):19607-16.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	A di-N-acetylchitobiase activity is involved in the lysosomal catabolism of asparagine-linked glycoproteins in rat liver.	Kuranda MJ and Aronson NN, J Biol Chem. 1986 May 5;261(13):5803-9.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:16502470	PMID:23376485	PMID:23558346

Genomics

Comparative Map Data

Ctbs
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	238,000,800 - 238,015,368 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	238,000,842 - 238,015,475 (+)	Ensembl				GRCr8
mRatBN7.2	2	235,340,520 - 235,355,091 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	235,340,547 - 235,355,091 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	243,136,262 - 243,150,803 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	241,027,676 - 241,042,213 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,893,896 - 235,908,437 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	237,897,460 - 237,911,946 (+)	NCBI
Lyon_Normotensive	2	238,021,601 - 238,036,087 (+)	NCBI
Lyon_Hypertensive	2	237,708,534 - 237,723,020 (+)	NCBI
F344_StmMcwi	2	237,771,094 - 237,785,580 (+)	NCBI
Rnor_6.0	2	252,305,874 - 252,320,387 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	252,305,874 - 252,320,387 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	2	270,832,838 - 270,847,352 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	244,648,365 - 244,662,878 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	227,320,301 - 227,334,815 (+)	NCBI		Celera
RGSC_v3.1	2	244,635,104 - 244,649,618 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

CTBS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	84,549,611 - 84,574,440 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	84,541,988 - 84,574,484 (-)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	1	85,015,294 - 85,040,123 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	84,792,810 - 84,812,686 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	84,732,242 - 84,752,119	NCBI
Celera	1	83,262,703 - 83,284,058 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,128,864 - 83,150,219 (-)	NCBI		HuRef
CHM1_1	1	85,133,631 - 85,154,990 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	84,389,989 - 84,414,814 (-)	NCBI		T2T-CHM13v2.0

Ctbs
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	146,156,204 - 146,171,604 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	146,155,550 - 146,174,064 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	146,450,449 - 146,465,849 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	146,449,795 - 146,465,849 (+)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	3	146,113,457 - 146,128,735 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	146,387,879 - 146,403,157 (+)	NCBI		MGSCv36	mm8
Celera	3	152,900,491 - 152,915,801 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI
cM Map	3	71.26	NCBI

Ctbs
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	9,327,945 - 9,343,923 (+)	Ensembl		ChiLan1.0 Ensembl
ChiLan1.0	NW_004955423	9,327,945 - 9,343,923 (+)	NCBI	ChiLan1.0	ChiLan1.0

CTBS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	142,320,961 - 142,387,422 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	141,475,528 - 141,541,913 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	117,102,555 - 117,169,745 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	85,963,137 - 85,982,907 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	85,962,647 - 85,982,907 (-)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

CTBS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	63,308,013 - 63,342,697 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	63,308,420 - 63,342,266 (+)	Ensembl		CanFam3.1 Ensembl	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	65,955,414 - 65,991,609 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,846,787 - 63,882,969 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,846,818 - 63,936,830 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	63,375,119 - 63,411,275 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	63,343,877 - 63,380,014 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,849,700 - 63,885,875 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ctbs
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mIctTri1.hap1	11	67,845,801 - 67,865,863 (-)	NCBI		mIctTri1.hap1
HiC_Itri_2	NW_024405058	95,242,051 - 95,263,240 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	1,048,922 - 1,068,761 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936608	1,048,696 - 1,064,383 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CTBS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	129,173,444 - 129,207,863 (+)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	6	129,173,399 - 129,207,868 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	119,601,501 - 119,617,420 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTBS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	20	52,293,835 - 52,318,277 (+)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666033	68,964,965 - 68,986,020 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	20	48,782,711 - 48,827,463 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	48,782,766 - 48,804,591 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Ctbs
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624742	12,911,108 - 12,926,482 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2
HetGla_female_1.0 Ensembl	NW_004624742	12,911,269 - 12,926,010 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
Naked mole-rat maternal Ensembl	19	41,738,293 - 41,754,372 (+)	Ensembl

Ctbs
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	14,450,497 - 14,465,763 (-)	NCBI	Rrattus_CSIRO_v1	Rrattus_CSIRO_v1

Variants

Variants in Ctbs
208 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	21
Count of miRNA genes:	20
Interacting mature miRNAs:	21
Transcripts:	ENSRNOT00000020972
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat

Markers in Region

BE113911

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	235,349,163 - 235,349,335 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	252,314,463 - 252,314,634	NCBI	Rnor6.0
Rnor_5.0	2	270,841,428 - 270,841,599	UniSTS	Rnor5.0
RGSC_v3.4	2	244,656,954 - 244,657,125	UniSTS	RGSC3.4
Celera	2	227,328,891 - 227,329,062	UniSTS
Cytogenetic Map	2	q44	UniSTS

AV266943

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	238,009,564 - 238,009,669 (+)	Marker Load Pipeline
mRatBN7.2	2	235,349,286 - 235,349,392 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	252,314,586 - 252,314,691	NCBI	Rnor6.0
Rnor_5.0	2	270,841,551 - 270,841,656	UniSTS	Rnor5.0
RGSC_v3.4	2	244,657,077 - 244,657,182	UniSTS	RGSC3.4
Celera	2	227,329,014 - 227,329,119	UniSTS
Cytogenetic Map	2	q44	UniSTS

BF403356

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	235,345,227 - 235,345,331 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	252,310,527 - 252,310,630	NCBI	Rnor6.0
Rnor_5.0	2	270,837,491 - 270,837,594	UniSTS	Rnor5.0
RGSC_v3.4	2	244,653,018 - 244,653,121	UniSTS	RGSC3.4
Celera	2	227,324,966 - 227,325,069	UniSTS
Cytogenetic Map	2	q44	UniSTS

AI178777

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	235,354,528 - 235,354,621 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	252,319,828 - 252,319,920	NCBI	Rnor6.0
Rnor_5.0	2	270,846,793 - 270,846,885	UniSTS	Rnor5.0
RGSC_v3.4	2	244,662,319 - 244,662,411	UniSTS	RGSC3.4
Celera	2	227,334,256 - 227,334,348	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
277	156	729	1591	4047	1011	1727	133	874	488	856	156	5388	2588	446	3960	38	1392	741	908	160	158

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103211	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M95768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020972 ⟹ ENSRNOP00000020972

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	238,000,842 - 238,015,475 (+)	Ensembl
mRatBN7.2 Ensembl	2	235,340,547 - 235,355,091 (+)	Ensembl
Rnor_6.0 Ensembl	2	252,305,874 - 252,320,387 (+)	Ensembl

RefSeq Acc Id:

NM_031023 ⟹ NP_112285

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	238,000,851 - 238,015,365 (+)	NCBI
mRatBN7.2	2	235,340,575 - 235,355,088 (+)	NCBI
Dahl_SR_JrHsd	2	237,897,460 - 237,911,946 (+)	NCBI
Lyon_Normotensive	2	238,021,601 - 238,036,087 (+)	NCBI
Lyon_Hypertensive	2	237,708,534 - 237,723,020 (+)	NCBI
F344_StmMcwi	2	237,771,094 - 237,785,580 (+)	NCBI
Rnor_6.0	2	252,305,874 - 252,320,387 (+)	NCBI
Rnor_5.0	2	270,832,838 - 270,847,352 (+)	NCBI
RGSC_v3.4	2	244,648,365 - 244,662,878 (+)	RGD
Celera	2	227,320,301 - 227,334,815 (+)	RGD

Sequence:

show sequence

ATGGCGCTGAGTGACCTCCTGGAACTCACTCTGCTGCTGCTGCTGCCCCTGCTGGAGCGGCTCT
CGGCCGAGGACTGCCCGTGCTCCGAGGCTTCTCTCTGCCGACCGATCCGCCACCACCGCGACTT
CGAGGTCTTTGTGTTTGATGTTGGACAGAAAACCTGGAAATCTTATGACTGGTCGCAGATTACG
ACTGTGGCAGTTTTTGGAAAATATGACTCAGAACTTATGTGCTATGCTCATTCGAAAGGAGCCA
GGGTAGTGCTAAAAGGTGATGTGGCCCTGAAGGACATCATTAATCCTACCTTCAGAGCGTCATG
GATAGCGCAAAAAGTTGCCTTAGCCAAAGCACAACACATGGATGGAATTAATATAGACATAGAA
CAGGAAGTTGATTGCTCGTCACCTGAATATGAAGCATTGACAGCTTTGGTCAGAGAAACCACAG
AGGGTTTCCATCGTGAGATTGAGGGATCACAGGTAACTTTTGATGTAGCTTGGTCACCAAAGGG
CATAGACAAAAGGTGCTATAATTATACTGGGATTGCGGATGCCTGCGACTTTCTTTTTGTGATG
TCTTACGATGAGCAAAGTCAGATCTGGTCAGAATGTATTGCAGCCGCCAATGCTCCCTACAATC
AGACATTAACTGGATATGGTGACTACCTCAGGATGGGCATCAGCCCCAGGAAACTTGTAATGGG
TATTCCCTGGTATGGCTATGATTACATTTGCCTAAACCTCTCAAAGGATGATGTCTGCGCCATT
GCAAAGGTCCCTTTCAGAGGGGCTCCTTGCAGTGATGCTGCAGGGCATCAGGTGCCCTACAGGG
TCATCATGAAGCAAGTAAACAGTTCTGTTTCTGGAAGCCAGTGGAACCAAGACCAGCAAGCTCC
GTACTATAATTACAAGGATCCCACTGGCCGTTTGCATCAGGTGTGGTACGATAACCCCCGGAGC
ATCTCACTAAAGGCAGCATTCGTCAAACACTACGGCTTGCGGGGCATTGGCATGTGGAACGCGA
ACTGTCTGGACTACTCAGATGACGCTCTAGCCAGAGAGCAAACGGAGGAAATGTGGGGAGCCCT
GAGACCACGGCTGTGATACATACAGAGGAATGTCTTTTGTCAGACGGTTAGATTTGCAGGACTG
GCCTGTGTAAGCAGATCTACCTCTTCAAGAGATAAAAATATATATTTTGTCATGTTACCCTAAC
TTACTTATTGGTCTACTCAATACACAGGAAAGAAATAAAGAAACTATTCATTTGTACTTGGAAA
ATACATACATATCTTAAATATCCAGGAATGTAAAAGCAAAAACAAGTCAACTTACTCTATTAAA
TATTCCTCTGTTTCAGTATTATAATTATATTATATTATAATTAGAAAAGTTGCTTTTAGAATTC
CATGCTGAATTTTTCCTCCTGTTATTAAAATATACTGTTAAAAACCAATAGGGATTTTTAAAAA
TGTATAACTAGTAGACAAGTGAAGATACTGGAGAAGGGAGTGCACATGACCATAGTGTGTTACA
CACATGTATAGACTATCATAGTAAAGCCCATTATTTTTATAATTAATATATGCTAATAAAAGAT
GTGTAACTTGAAATGG

hide sequence

RefSeq Acc Id:

XM_039103211 ⟹ XP_038959139

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	238,000,800 - 238,015,368 (+)	NCBI
mRatBN7.2	2	235,340,520 - 235,355,091 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_112285	(Get FASTA)	NCBI Sequence Viewer
	XP_038959139	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40924	(Get FASTA)	NCBI Sequence Viewer
	AAH88129	(Get FASTA)	NCBI Sequence Viewer
	EDL82422	(Get FASTA)	NCBI Sequence Viewer
	EDL82423	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020972
	ENSRNOP00000020972.2
	ENSRNOP00055032656
	ENSRNOP00060000375
	ENSRNOP00065016158
GenBank Protein	Q01460	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112285 ⟸ NM_031023
- Peptide Label:	precursor
- UniProtKB:	Q01460 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MALSDLLELTLLLLLPLLERLSAEDCPCSEASLCRPIRHHRDFEVFVFDVGQKTWKSYDWSQIT TVAVFGKYDSELMCYAHSKGARVVLKGDVALKDIINPTFRASWIAQKVALAKAQHMDGINIDIE QEVDCSSPEYEALTALVRETTEGFHREIEGSQVTFDVAWSPKGIDKRCYNYTGIADACDFLFVM SYDEQSQIWSECIAAANAPYNQTLTGYGDYLRMGISPRKLVMGIPWYGYDYICLNLSKDDVCAI AKVPFRGAPCSDAAGHQVPYRVIMKQVNSSVSGSQWNQDQQAPYYNYKDPTGRLHQVWYDNPRS ISLKAAFVKHYGLRGIGMWNANCLDYSDDALAREQTEEMWGALRPRL hide sequence

Ensembl Acc Id:

ENSRNOP00000020972 ⟸ ENSRNOT00000020972

RefSeq Acc Id:	XP_038959139 ⟸ XM_039103211
- Peptide Label:	isoform X1

Protein Domains

GH18

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q01460-F1-model_v2	AlphaFold	Q01460	1-367	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691813

Promoter ID:

EPDNEW_R2338

Type:

multiple initiation site

Name:

Ctbs_1

Description:

chitobiase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	252,305,850 - 252,305,910	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621338	AgrOrtholog
BioCyc Gene	G2FUF-50902	BioCyc
Ensembl Genes	ENSRNOG00000015573	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055023400	UniProtKB/Swiss-Prot
	ENSRNOG00060000862	UniProtKB/Swiss-Prot
	ENSRNOG00065012824	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020972	ENTREZGENE
	ENSRNOT00000020972.6	UniProtKB/Swiss-Prot
	ENSRNOT00055040216	UniProtKB/Swiss-Prot
	ENSRNOT00060001070	UniProtKB/Swiss-Prot
	ENSRNOT00065020953	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.50.10	UniProtKB/Swiss-Prot
	Glycosidases	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7323494	IMAGE-MGC_LOAD
InterPro	Chitinase_II	UniProtKB/Swiss-Prot
	Chitinase_insertion_sf	UniProtKB/Swiss-Prot
	DIAC_cat	UniProtKB/Swiss-Prot
	GH18_Domain-Containing	UniProtKB/Swiss-Prot
	Glyco_hydro18_cat	UniProtKB/Swiss-Prot
	Glyco_hydro_18_chit_AS	UniProtKB/Swiss-Prot
	Glycoside_hydrolase_SF	UniProtKB/Swiss-Prot
KEGG Report	rno:81652	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108665	IMAGE-MGC_LOAD
NCBI Gene	81652	ENTREZGENE
PANTHER	DI-N-ACETYLCHITOBIASE	UniProtKB/Swiss-Prot
	DI-N-ACETYLCHITOBIASE	UniProtKB/Swiss-Prot
Pfam	Glyco_hydro_18	UniProtKB/Swiss-Prot
PhenoGen	Ctbs	PhenoGen
PROSITE	CHITINASE_18	UniProtKB/Swiss-Prot
	GH18_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015573	RatGTEx
	ENSRNOG00055023400	RatGTEx
	ENSRNOG00060000862	RatGTEx
	ENSRNOG00065012824	RatGTEx
SMART	Glyco_18	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF51445	UniProtKB/Swiss-Prot
UniProt	DIAC_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Ctbs	chitobiase	Ctbs	chitobiase, di-N-acetyl-	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ctbs	chitobiase, di-N-acetyl-		di-N-acetylchitobiase	Name updated	1299863	APPROVED
2002-08-07	Ctbs	di-N-acetylchitobiase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	344 amino acids; 40 kDa	728173

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar