Fntb (farnesyltransferase, CAAX box, subunit beta)

Gene: Fntb (farnesyltransferase, CAAX box, subunit beta) Rattus norvegicus

Analyze

Symbol:

Fntb

Name:

farnesyltransferase, CAAX box, subunit beta (Ensembl:farnesyltransferase, CAAX box, beta)

RGD ID:

620119

Description:

Contributes to peptide binding activity and protein farnesyltransferase activity. Involved in several processes, including positive regulation of cell cycle; positive regulation of cell population proliferation; and positive regulation of nitric-oxide synthase biosynthetic process. Predicted to be part of microtubule associated complex and protein farnesyltransferase complex. Human ortholog(s) of this gene implicated in anxiety disorder. Orthologous to several human genes including FNTB (farnesyltransferase, CAAX box, subunit beta); INTERACTS WITH (S)-(-)-perillyl alcohol; 1,2,4-trimethylbenzene; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CAAX farnesyltransferase subunit beta; farnesyltransferase beta subunit; farnesyltransferase, CAAX box, beta; FTase-beta; MGC105303; protein farnesyltransferase subunit beta; ras proteins prenyltransferase subunit beta

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FNTB (farnesyltransferase, CAAX box, subunit beta)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fntb (farnesyltransferase, CAAX box, beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fntb (farnesyltransferase, CAAX box, subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FNTB (farnesyltransferase, CAAX box, subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FNTB (farnesyltransferase, CAAX box, beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101978376 (protein farnesyltransferase subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FNTB (farnesyltransferase, CAAX box, beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FNTB (farnesyltransferase, CAAX box, subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fntb (farnesyltransferase, CAAX box, subunit beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CHURC1 (churchill domain containing 1)	HGNC	EggNOG, Inparanoid, OrthoDB, Treefam
Homo sapiens (human):	CHURC1-FNTB (CHURC1-FNTB readthrough)	HGNC	EggNOG, OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Fntb (farnesyltransferase, CAAX box, beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FNTB (farnesyltransferase, CAAX box, subunit beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CHURC1-FNTB (CHURC1-FNTB readthrough)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fntb (farnesyltransferase, CAAX box, beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17565	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RAM1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fntb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fntb	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,269,657 - 101,352,716 (+)	NCBI		GRCr8
mRatBN7.2	6	95,536,540 - 95,619,587 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,470,683 - 95,619,586 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	95,925,102 - 96,014,540 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,223,633 - 96,313,088 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,652,452 - 95,741,900 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,883,959 - 99,966,988 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,883,959 - 99,966,988 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	109,278,424 - 109,361,572 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	99,427,967 - 99,511,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	99,431,422 - 99,514,829 (+)	NCBI
Celera	6	93,954,767 - 94,037,720 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anxiety disorder (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Islet Cell Tumor Syndrome (ISO)

pheochromocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-(-)-perillyl alcohol (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

2-trans,6-trans-farnesyl diphosphate (EXP)

aflatoxin B1 (EXP)

alachlor (EXP)

all-trans-retinoic acid (ISO)

all-trans-retinol (EXP)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP,ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

curcumin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

farnesol (ISO)

farnesyl diphosphate (EXP)

fenthion (ISO)

flavonoids (EXP)

folic acid (ISO)

formaldehyde (ISO)

graphite (EXP)

GW 4064 (ISO)

hydrogen peroxide (ISO)

iron atom (EXP)

iron(0) (EXP)

methapyrilene (ISO)

methyl methanesulfonate (ISO)

oleic acid (ISO)

oxaliplatin (EXP)

perfluorohexanesulfonic acid (ISO)

perillyl alcohol (EXP)

rac-lactic acid (ISO)

sodium arsenite (ISO)

Soman (EXP)

temozolomide (ISO)

theophylline (ISO)

topotecan (EXP)

valproic acid (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell population proliferation (ISO)

fibroblast growth factor receptor signaling pathway (IBA)

fibroblast proliferation (ISO)

lipid metabolic process (IEA)

negative regulation of cell population proliferation (ISO)

positive regulation of cell cycle (IMP)

positive regulation of cell population proliferation (IMP,ISO)

positive regulation of DNA-templated transcription (IEA)

positive regulation of fibroblast proliferation (ISO)

positive regulation of nitric-oxide synthase biosynthetic process (IMP)

prenylation (IEA)

regulation of fibroblast proliferation (ISO)

response to cytokine (IMP)

response to inorganic substance (IMP)

response to organic cyclic compound (IMP)

wound healing (ISO)

Cellular Component

microtubule associated complex (IEA,ISO)

protein farnesyltransferase complex (IBA,IEA,ISO,ISS)

Molecular Function

farnesyltranstransferase activity (ISO)

peptide binding (IDA)

protein binding (IPI,ISO)

protein farnesyltransferase activity (IBA,IDA,IEA,ISO)

zinc ion binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	cDNA cloning and expression of the peptide-binding beta subunit of rat p21ras farnesyltransferase, the counterpart of yeast DPR1/RAM1.	Chen WJ, etal., Cell 1991 Jul 26;66(2):327-34.
2.	Novel and selective imidazole-containing biphenyl inhibitors of protein farnesyltransferase.	Curtin ML, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1367-71.
3.	Isothiazole dioxide derivative 6n inhibits vascular smooth muscle cell proliferation and protein farnesylation.	Ferri N, etal., Biochem Pharmacol. 2005 Dec 5;70(12):1735-43. Epub 2005 Oct 28.
4.	Inhibition of protein geranylgeranylation causes a superinduction of nitric-oxide synthase-2 by interleukin-1beta in vascular smooth muscle cells.	Finder JD, etal., J Biol Chem. 1997 May 23;272(21):13484-8.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.	Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1359-62.
8.	Aryl tetrahydropyridine inhibitors of farnesyltransferase: bioavailable analogues with improved cellular potency.	Gwaltney SL 2nd, etal., Bioorg Med Chem Lett. 2003 Apr 7;13(7):1363-6.
9.	Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.	Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
10.	The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.	Long SB, etal., Structure. 2000 Feb 15;8(2):209-22.
11.	Combination of the novel farnesyltransferase inhibitor RPR130401 and the geranylgeranyltransferase-1 inhibitor GGTI-298 disrupts MAP kinase activation and G(1)-S transition in Ki-Ras-overexpressing transformed adrenocortical cells.	Mazet JL, etal., FEBS Lett. 1999 Oct 29;460(2):235-40.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Crystal structure of protein farnesyltransferase at 2.25 angstrom resolution.	Park HW, etal., Science. 1997 Mar 21;275(5307):1800-4.
15.	Crystal structures of the anticancer clinical candidates R115777 (Tipifarnib) and BMS-214662 complexed with protein farnesyltransferase suggest a mechanism of FTI selectivity.	Reid TS and Beese LS, Biochemistry. 2004 Jun 8;43(22):6877-84.
16.	Crystallographic analysis reveals that anticancer clinical candidate L-778,123 inhibits protein farnesyltransferase and geranylgeranyltransferase-I by different binding modes.	Reid TS, etal., Biochemistry. 2004 Jul 20;43(28):9000-8.
17.	Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.	Reid TS, etal., J Mol Biol. 2004 Oct 15;343(2):417-33.
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Role of the carboxyterminal residue in peptide binding to protein farnesyltransferase and protein geranylgeranyltransferase.	Roskoski R Jr and Ritchie P, Arch Biochem Biophys. 1998 Aug 15;356(2):167-76.
21.	Tricyclic farnesyl protein transferase inhibitors: crystallographic and calorimetric studies of structure-activity relationships.	Strickland CL, etal., J Med Chem. 1999 Jun 17;42(12):2125-35.
22.	Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.	Tong Y, etal., Bioorg Med Chem Lett. 2003 May 5;13(9):1571-4.
23.	Biochemical and structural studies with prenyl diphosphate analogues provide insights into isoprenoid recognition by protein farnesyl transferase.	Turek-Etienne TC, etal., Biochemistry. 2003 Apr 8;42(13):3716-24.
24.	Properties and kinetic mechanism of recombinant mammalian protein geranylgeranyltransferase type I.	Zhang FL, etal., J Biol Chem. 1994 Sep 23;269(38):23465-70.
25.	TrkB-mediated activation of geranylgeranyltransferase I promotes dendritic morphogenesis.	Zhou XP, etal., Proc Natl Acad Sci U S A. 2008 Nov 4;105(44):17181-6. Epub 2008 Oct 28.

Additional References at PubMed

PMID:7673206	PMID:9657673	PMID:9843427	PMID:11687658	PMID:12477932	PMID:15489334	PMID:15837621	PMID:16893176	PMID:19228685	PMID:23686339	PMID:26192016	PMID:29282289

Genomics

Comparative Map Data

Fntb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,269,657 - 101,352,716 (+)	NCBI		GRCr8
mRatBN7.2	6	95,536,540 - 95,619,587 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,470,683 - 95,619,586 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	95,925,102 - 96,014,540 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,223,633 - 96,313,088 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,652,452 - 95,741,900 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,883,959 - 99,966,988 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,883,959 - 99,966,988 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	109,278,424 - 109,361,572 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	99,427,967 - 99,511,373 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	99,431,422 - 99,514,829 (+)	NCBI
Celera	6	93,954,767 - 94,037,720 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

FNTB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	64,986,895 - 65,062,650 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	64,986,895 - 65,062,652 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	65,453,613 - 65,529,368 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	64,523,260 - 64,599,123 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	64,523,259 - 64,599,122	NCBI
Celera	14	45,508,091 - 45,583,963 (+)	NCBI		Celera
Cytogenetic Map	14	q23.3	NCBI
HuRef	14	45,622,838 - 45,698,636 (+)	NCBI		HuRef
CHM1_1	14	65,391,707 - 65,467,529 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	59,191,767 - 59,267,508 (+)	NCBI		T2T-CHM13v2.0

Fntb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	76,884,014 - 76,968,188 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	76,812,363 - 76,968,186 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	76,837,400 - 76,921,412 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	76,765,589 - 76,921,412 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	77,938,454 - 78,022,399 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	77,756,307 - 77,840,252 (+)	NCBI		MGSCv36	mm8
Celera	12	77,919,908 - 78,003,339 (+)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	33.73	NCBI

Fntb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	4,855,509 - 5,013,568 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955466	4,858,628 - 4,940,247 (-)	NCBI	ChiLan1.0	ChiLan1.0

FNTB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	66,095,351 - 66,174,358 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	65,313,473 - 65,390,871 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	45,568,511 - 45,643,952 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	64,448,173 - 64,522,632 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	64,448,170 - 64,522,632 (+)	Ensembl	panpan1.1		panPan2

FNTB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	39,364,067 - 39,429,129 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	39,056,154 - 39,121,139 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	39,586,882 - 39,651,960 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	39,586,923 - 39,651,894 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	39,207,903 - 39,272,691 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	39,280,638 - 39,345,195 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	39,639,759 - 39,704,379 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101978376
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	65,477,747 - 65,554,529 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	8,567,894 - 8,713,978 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	8,637,103 - 8,713,952 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FNTB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	89,052,507 - 89,131,072 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	89,052,451 - 89,131,075 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	95,473,097 - 95,507,362 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FNTB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	42,197,998 - 42,275,863 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	42,198,704 - 42,276,898 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	30,373,890 - 30,450,958 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fntb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	35,964,914 - 36,117,852 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	35,965,240 - 36,051,685 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fntb
403 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	198
Count of miRNA genes:	133
Interacting mature miRNAs:	166
Transcripts:	ENSRNOT00000010588
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat

Markers in Region

RH129066

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	95,619,302 - 95,619,489 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,966,705 - 99,966,891	NCBI	Rnor6.0
Rnor_5.0	6	109,361,289 - 109,361,475	UniSTS	Rnor5.0
RGSC_v3.4	6	99,511,090 - 99,511,276	UniSTS	RGSC3.4
Celera	6	94,037,437 - 94,037,623	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	24	24	18	11	18			72	20	30	3
Low	1	19	33	23	8	23	8	11	2	15	11	8	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_172034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M69056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000009621 ⟹ ENSRNOP00000009620

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,470,683 - 95,485,198 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000010588 ⟹ ENSRNOP00000010588

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,536,587 - 95,619,586 (+)	Ensembl
Rnor_6.0 Ensembl	6	99,883,959 - 99,966,988 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094814 ⟹ ENSRNOP00000094000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,470,683 - 95,485,559 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000099844 ⟹ ENSRNOP00000079445

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,536,587 - 95,619,586 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104862 ⟹ ENSRNOP00000079737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,476,429 - 95,485,203 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109454 ⟹ ENSRNOP00000094703

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,470,934 - 95,485,192 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000120259 ⟹ ENSRNOP00000080450

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	95,470,683 - 95,619,586 (+)	Ensembl

RefSeq Acc Id:

NM_172034 ⟹ NP_742031

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,269,722 - 101,352,716 (+)	NCBI
mRatBN7.2	6	95,536,587 - 95,619,586 (+)	NCBI
Rnor_6.0	6	99,883,959 - 99,966,988 (+)	NCBI
Rnor_5.0	6	109,278,424 - 109,361,572 (+)	NCBI
RGSC_v3.4	6	99,427,967 - 99,511,373 (+)	RGD
Celera	6	93,954,767 - 94,037,720 (+)	RGD

Sequence:

show sequence

CTGGACGAAGCTGAGTCCTATACAGCGCTCGCAGCTCTCCCGATCATGGCTTCTTCGAGTTCCT
TCACCTATTATTGTCCTCCATCTTCTTCCCCTGTTTGGTCAGAACCGCTGTATAGTCTGAGACC
TGAGCACGCGCGGGAGCGGTTGCAAGACGACTCAGTGGAAACAGTCACGTCCATAGAACAGGCC
AAAGTAGAAGAAAAGATCCAGGAGGTCTTCAGTTCTTACAAGTTTAACCACCTCGTACCAAGGC
TTGTTCTGCAGAGGGAGAAGCACTTCCATTATCTGAAAAGAGGCCTTCGACAACTGACAGATGC
CTATGAGTGTCTGGATGCCAGCCGCCCCTGGCTCTGCTACTGGATCCTGCACAGCTTGGAGCTC
CTCGACGAACCCATCCCCCAAATAGTGGCTACAGATGTGTGTCAGTTCTTGGAGCTGTGTCAGA
GTCCAGACGGTGGCTTTGGAGGGGGCCCTGGTCAGTACCCACACCTCGCTCCCACGTATGCAGC
TGTCAACGCGCTATGCATCATTGGCACGGAGGAAGCCTACAACGTCATTAACAGAGAGAAGCTC
CTTCAGTACTTGTACTCCCTAAAGCAACCGGATGGCTCTTTTCTCATGCACGTCGGAGGAGAGG
TGGATGTAAGAAGTGCGTACTGTGCTGCCTCAGTAGCCTCTCTCACCAACATCATCACTCCTGA
CCTCTTCGAAGGCACTGCTGAATGGATAGCAAGGTGCCAGAACTGGGAAGGCGGCATTGGCGGG
GTGCCAGGGATGGAAGCCCACGGTGGCTACACCTTCTGTGGCTTGGCTGCGCTGGTGATCCTCA
AGAAGGAACGTTCTTTGAACCTGAAGAGCTTGCTACAATGGGTGACAAGCCGGCAGATGCGGTT
CGAAGGAGGATTTCAGGGCCGCTGCAACAAGCTGGTGGACGGCTGCTACTCCTTCTGGCAGGCA
GGACTTCTGCCCCTGTTGCACCGGGCACTCCACGCTCAAGGTGACCCTGCCCTCAGCATGAGCC
ACTGGATGTTCCATCAGCAGGCGCTGCAGGAGTACATCCTCATGTGCTGCCAGTGTCCGGCTGG
GGGTCTCCTGGACAAACCTGGCAAGTCACGTGACTTCTACCATACTTGCTACTGCCTGAGCGGC
CTGTCCATTGCCCAGCATTTTGGAAGTGGAGCCATGCTGCACGATGTGGTCATGGGTGTGCCTG
AAAATGTTCTGCAGCCCACTCACCCTGTGTACAACATCGGACCTGATAAGGTGATCCAGGCCAC
CACACACTTTCTGCAGAAGCCGGTCCCAGGCTTTGAGGAATGCGAAGATGCGGTGACCTCAGAT
CCTGCCACTGACTAGAGGACCCCATGGCTCCCCCAAATCCCCCGTCAGACAAGGTTTCTCCGTT
TGGGTACATAGCACAGTCCGTGCTACTTGAGCCTTGGCCACTGTGGAGTTGTGGTTTCTTTGTC
CTTTCCTGTCAAACAAAACAAAGCCATCAGCTCTGGGTTGGAATACACAATGGTGTGATTTTAA
AAATTATTTTCATACCTGTCAAACCAAAACTCTGGGAGCCGATGTAGTAAGCAGGGTTGGAGAG
CAATGCATGCTGGGAAGCAGCAGCCTCCTCCAGCAGCCAGGCCCACAATGCTGAAATGGAAGGT
GTCTGTGAGTATCTCCACATCACAGCCACTGCTGTGCCTCCCACCTACACACCATTCAGTCAGC
AGATGGGCTCCTCTCTGGTATAAATGTCAGCTCTGTGCAAGGGCGGGGCTGTGGGTCCAGCCAA
TACATGCTCTCTGGAAAACAGCACTGGGCTCCAGTGGGCATATTCATACTTGTCTCTTTTACCC
CAGTCATTTGCGAAGGACAGGGGCCAGGAATGAAGAAGGGTCTTAGATTGAGCCTTCCCCACAA
CCTGAGGAGAACTGATCTCATATTTCTCCAAGGCCATGTTTGTATGAGCAAGACTTGTTTTGCC
CTAAGTATGACGACTAGACCCAGGTAATCAATTATGAGTGGAAAATCAACCTCTAGGTGAACTC
TGTGCCAGAGGAAGCAGCCTCCCCAGTGCCCAGCCCCTGCCTCTCCCCATCATGTACCAGGAGA
GGCCCTCCTCACGGCAGTGCTGCAGCCCAGGCTCCTTCTAGTCCTTTCTCCCCACCCACCCTCC
AAGACAGTGCTCTTTTCTCATCCAGGGTGTTAACACTACTAAGGCTTCACCGTAATCGATCACT
CAGGATTTACTCCTGCCCTGCCCACTCCAGGCTCTCTGAAACACAGTCAAGTGCTAGGCAAGCT
AGCTGCTGCTGGGACAGTGACCAGCAGGAAGGCAAGTGCTGTCCGTGTGCTGAATTCTGGAACT
GCCTCTGCACCGGCTGAGTTTGCTCACCTATCCACTGCTACAGTCATAGCAAGCTCATGCCGCT
GTCCCAGCCTGTGCGAGCAGGCAGACGGGAGCTTGGAGATGCAGCATGAGGTTCTTCCCCAAAC
CACTGGCCATTTGCTGCCTCTGATTCCCCATTGCTTTGGTGTACTGGGCTATGTATTACCTCCT
TGAAATAATAAAAGAGTAACATTTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039112877 ⟹ XP_038968805

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,269,657 - 101,352,716 (+)	NCBI
mRatBN7.2	6	95,536,540 - 95,619,587 (+)	NCBI

RefSeq Acc Id:

XM_063262446 ⟹ XP_063118516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,270,058 - 101,352,716 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_742031	(Get FASTA)	NCBI Sequence Viewer
	XP_038968805	(Get FASTA)	NCBI Sequence Viewer
	XP_063118516	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41176	(Get FASTA)	NCBI Sequence Viewer
	AAH87675	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010588
	ENSRNOP00000010588.3
	ENSRNOP00000079445
	ENSRNOP00000079445.1
	ENSRNOP00000080450.1
	ENSRNOP00000094703.1
	ENSRNOP00055028662
	ENSRNOP00060043901
	ENSRNOP00065027091
GenBank Protein	Q02293	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_742031 ⟸ NM_172034

- UniProtKB:

Q02293 (UniProtKB/Swiss-Prot), A6HCB6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASSSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKF
NHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQ
FLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFL
MHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGL
AALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHD
VVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGFEECEDAVTSDPATD

hide sequence

RefSeq Acc Id:

ENSRNOP00000010588 ⟸ ENSRNOT00000010588

RefSeq Acc Id:	XP_038968805 ⟸ XM_039112877
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZMQ9 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000094000 ⟸ ENSRNOT00000094814

RefSeq Acc Id:

ENSRNOP00000079737 ⟸ ENSRNOT00000104862

RefSeq Acc Id:

ENSRNOP00000009620 ⟸ ENSRNOT00000009621

RefSeq Acc Id:

ENSRNOP00000079445 ⟸ ENSRNOT00000099844

RefSeq Acc Id:

ENSRNOP00000094703 ⟸ ENSRNOT00000109454

RefSeq Acc Id:

ENSRNOP00000080450 ⟸ ENSRNOT00000120259

RefSeq Acc Id:	XP_063118516 ⟸ XM_063262446
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q02293-F1-model_v2	AlphaFold	Q02293	1-437	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694682

Promoter ID:

EPDNEW_R5207

Type:

initiation region

Name:

Fntb_1

Description:

farnesyltransferase, CAAX box, beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	99,883,912 - 99,883,972	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620119	AgrOrtholog
BioCyc Gene	G2FUF-37041	BioCyc
Ensembl Genes	ENSRNOG00000007660	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055020713	UniProtKB/Swiss-Prot
	ENSRNOG00060030412	UniProtKB/Swiss-Prot
	ENSRNOG00065020087	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010588	ENTREZGENE
	ENSRNOT00000010588.5	UniProtKB/Swiss-Prot
	ENSRNOT00000099844.1	UniProtKB/TrEMBL
	ENSRNOT00000109454.1	UniProtKB/TrEMBL
	ENSRNOT00000120259.1	UniProtKB/TrEMBL
	ENSRNOT00055035360	UniProtKB/Swiss-Prot
	ENSRNOT00060052814	UniProtKB/Swiss-Prot
	ENSRNOT00065033869	UniProtKB/Swiss-Prot
Gene3D-CATH	1.50.10.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.40.4240	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7319293	IMAGE-MGC_LOAD
InterPro	Churchill_sf	UniProtKB/TrEMBL
	FTB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PFTB_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PGGT1B-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Terpenoid_cyclase/PrenylTrfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transcrpt_activator_Churchill	UniProtKB/TrEMBL
KEGG Report	rno:64511	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105303	IMAGE-MGC_LOAD
NCBI Gene	64511	ENTREZGENE
PANTHER	PROTEIN CHURCHILL	UniProtKB/TrEMBL
	PROTEIN CHURCHILL	UniProtKB/TrEMBL
	PTHR11774	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11774:SF6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Churchill	UniProtKB/TrEMBL
	Prenyltrans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fntb	PhenoGen
RatGTEx	ENSRNOG00000007660	RatGTEx
	ENSRNOG00055020713	RatGTEx
	ENSRNOG00060030412	RatGTEx
	ENSRNOG00065020087	RatGTEx
Superfamily-SCOP	SSF48239	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZMQ9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZQQ4_RAT	UniProtKB/TrEMBL
	A0A8I6GKV7_RAT	UniProtKB/TrEMBL
	A6HCB6	ENTREZGENE, UniProtKB/TrEMBL
	FNTB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-03-29	Fntb	farnesyltransferase, CAAX box, subunit beta	Fntb	farnesyltransferase, CAAX box, beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fntb	farnesyltransferase, CAAX box, beta		farnesyltransferase beta subunit	Name updated	1299863	APPROVED
2002-08-07	Fntb	farnesyltransferase beta subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	437 amino acids	728425

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar