Advanced Search (OLGA)

Gene: Barhl2 (BarH-like homeobox 2) Rattus norvegicus

Analyze

Symbol:

Barhl2

Name:

BarH-like homeobox 2

RGD ID:

620726

Description:

Enables DNA-binding transcription factor activity. Involved in nervous system development and regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in oral squamous cell carcinoma. Orthologous to human BARHL2 (BarH like homeobox 2); INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

bar-class homeodomain protein MBH1; Barh; BarH-class homeodomain transcription factor; BarH-like 2 (Drosophila); barH-like 2 homeobox protein; homeobox protein B-H1; LOC65050; MBH1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BARHL2 (BarH like homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Barhl2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Barhl2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BARHL2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BARHL2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Barhl2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BARHL2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BARHL2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Barhl2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Barhl2 (BarH like homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BARHL2 (BarH like homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Barhl2 (BarH like homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	barhl2 (BarH-like homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YOX1	Alliance	DIOPT (InParanoid\|PhylomeDB)
Drosophila melanogaster (fruit fly):	B-H1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	B-H1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	B-H2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-31	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-31	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	barhl2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	barhl2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	3,485,309 - 3,490,206 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	3,485,309 - 3,490,197 (+)	Ensembl				GRCr8
mRatBN7.2	14	3,340,465 - 3,345,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	3,340,465 - 3,345,353 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	3,212,127 - 3,217,012 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	4,513,629 - 4,518,514 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	3,213,991 - 3,218,875 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	4,362,717 - 4,367,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	4,362,717 - 4,367,605 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	4,356,650 - 4,361,547 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	3,888,153 - 3,893,050 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	3,342,723 - 3,347,622 (+)	NCBI		Celera
RGSC_v3.1	14	3,888,152 - 3,893,041 (+)	NCBI
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colorectal cancer (ISO)

Lymphatic Metastasis (ISO)

oral squamous cell carcinoma (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

CGP 52608 (ISO)

choline (ISO)

copper(II) sulfate (ISO)

dimethyl sulfoxide (ISO)

flavonoids (EXP)

folic acid (ISO)

genistein (ISO)

L-methionine (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell fate commitment (ISO)

cell fate determination (ISO)

DNA-templated transcription (IEA)

nervous system development (IDA)

neuron differentiation (ISO)

neuron migration (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of translation (ISO)

regulation of axon extension (ISO)

regulation of DNA-templated transcription (IEA)

regulation of neuron differentiation (TAS)

regulation of transcription by RNA polymerase II (IBA,IDA)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IDA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Up-regulation of miR-187 modulates the advances of oral carcinoma by targeting BARX2 tumor suppressor.	Lin SC, etal., Oncotarget. 2016 Sep 20;7(38):61355-61365. doi: 10.18632/oncotarget.11349.
3.	Down-regulation of Barx2 predicts poor survival in colorectal cancer.	Mi Y, etal., Biochem Biophys Res Commun. 2016 Sep 9;478(1):67-73. doi: 10.1016/j.bbrc.2016.07.091. Epub 2016 Jul 22.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Mammalian BarH homologue is a potential regulator of neural bHLH genes.	Saito T, etal., Dev Biol 1998 Jul 15;199(2):216-25.
8.	BARHL2 Methylation Using Gastric Wash DNA or Gastric Juice Exosomal DNA is a Useful Marker For Early Detection of Gastric Cancer in an H. pylori-Independent Manner.	Yamamoto H, etal., Clin Transl Gastroenterol. 2016 Jul 21;7(7):e184. doi: 10.1038/ctg.2016.40.

Additional References at PubMed

PMID:12657654	PMID:14998930	PMID:18212062

Genomics

Comparative Map Data

Barhl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	3,485,309 - 3,490,206 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	3,485,309 - 3,490,197 (+)	Ensembl				GRCr8
mRatBN7.2	14	3,340,465 - 3,345,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	3,340,465 - 3,345,353 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	3,212,127 - 3,217,012 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	4,513,629 - 4,518,514 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	3,213,991 - 3,218,875 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	4,362,717 - 4,367,614 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	4,362,717 - 4,367,605 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	4,356,650 - 4,361,547 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	3,888,153 - 3,893,050 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	3,342,723 - 3,347,622 (+)	NCBI		Celera
RGSC_v3.1	14	3,888,152 - 3,893,041 (+)	NCBI
Cytogenetic Map	14	p22	NCBI

BARHL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	90,711,539 - 90,717,302 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	90,711,539 - 90,717,302 (-)	Ensembl			hg38	GRCh38
GRCh37	1	91,177,096 - 91,182,859 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	90,950,167 - 90,955,382 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	90,889,599 - 90,894,815	NCBI
Celera	1	89,425,682 - 89,430,897 (-)	NCBI		Celera
Cytogenetic Map	1	p22.2	NCBI
HuRef	1	89,296,413 - 89,301,629 (-)	NCBI		HuRef
CHM1_1	1	91,292,732 - 91,297,947 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	90,555,903 - 90,561,666 (-)	NCBI		T2T-CHM13v2.0

Barhl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	106,600,389 - 106,606,032 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	106,600,389 - 106,606,032 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	106,452,523 - 106,458,166 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	106,452,523 - 106,458,166 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	106,881,542 - 106,887,185 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	106,881,542 - 106,887,185 (-)	NCBI		MGSCv36	mm8
Celera	5	103,565,328 - 103,570,954 (-)	NCBI		Celera
Cytogenetic Map	5	E5	NCBI
cM Map	5	51.43	NCBI

Barhl2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	3,516,660 - 3,522,536 (+)	Ensembl
ChiLan1.0	NW_004955423	3,516,973 - 3,522,459 (+)	NCBI	ChiLan1.0	ChiLan1.0

BARHL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	136,306,017 - 136,313,430 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	135,461,979 - 135,468,959 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	93,373,317 - 93,378,667 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	92,121,017 - 92,126,036 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	92,121,017 - 92,126,036 (-)	Ensembl			panPan2	panpan1.1

BARHL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	57,971,077 - 57,977,197 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	57,971,018 - 57,977,211 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	60,675,782 - 60,681,623 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	58,355,942 - 58,361,782 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	58,355,347 - 58,361,798 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	58,029,710 - 58,035,547 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	58,005,081 - 58,010,922 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	58,485,088 - 58,490,931 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Barhl2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	100,812,786 - 100,818,760 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936537	8,129,207 - 8,135,237 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936537	8,129,213 - 8,134,744 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BARHL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	126,029,437 - 126,036,210 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	126,030,373 - 126,035,662 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	137,708,728 - 137,715,018 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BARHL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	42,743,465 - 42,757,833 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	42,743,888 - 42,749,876 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	75,223,048 - 75,228,743 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Barhl2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	7,027,069 - 7,034,308 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624742	7,027,122 - 7,033,342 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Barhl2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	16,163,106 - 16,168,229 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Barhl2
32 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	83
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000002887
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
71115	Niddm15	Non-insulin dependent diabetes mellitus QTL 15	4.8		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	11334906	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	17877928	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1	31893212	Rat

Markers in Region

Barhl2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	3,340,987 - 3,341,055 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	4,363,240 - 4,363,307	NCBI	Rnor6.0
Rnor_5.0	14	4,357,173 - 4,357,240	UniSTS	Rnor5.0
RGSC_v3.4	14	3,888,676 - 3,888,743	UniSTS	RGSC3.4
Celera	14	3,343,246 - 3,343,313	UniSTS
Cytogenetic Map	14	p22	UniSTS

AL034195

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	3,342,122 - 3,342,260 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	4,364,375 - 4,364,512	NCBI	Rnor6.0
Rnor_5.0	14	4,358,308 - 4,358,445	UniSTS	Rnor5.0
RGSC_v3.4	14	3,889,811 - 3,889,948	UniSTS	RGSC3.4
Celera	14	3,344,381 - 3,344,518	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	3	98	4	7	4	2	4	12	5	98	2	28	3	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB004056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002887 ⟹ ENSRNOP00000002887

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	3,485,309 - 3,490,197 (+)	Ensembl
mRatBN7.2 Ensembl	14	3,340,465 - 3,345,353 (+)	Ensembl
Rnor_6.0 Ensembl	14	4,362,717 - 4,367,605 (+)	Ensembl

RefSeq Acc Id:

NM_022956 ⟹ NP_075245

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	3,485,309 - 3,490,206 (+)	NCBI
mRatBN7.2	14	3,340,465 - 3,345,362 (+)	NCBI
Rnor_6.0	14	4,362,717 - 4,367,614 (+)	NCBI
Rnor_5.0	14	4,356,650 - 4,361,547 (+)	NCBI
RGSC_v3.4	14	3,888,153 - 3,893,050 (+)	RGD
Celera	14	3,342,723 - 3,347,622 (+)	RGD

Sequence:

show sequence

GATCGATAGTTTCCCTTGTTTGGTCCCGGAGGCGGCTGATCCGCGGAGTGGCGTGGACCTCATG
TAGAAATGACAGCAATGGAAGGGGCCAGCGGGTCGAGTTTTGGAATAGACACGATTTTGTCCGG
TGCCGGTTCCGGCAGTCCGGGCATGATGAACGGAGATTTCCGATCGCTCGGTGAAGCGAGGACC
ACGGATTTTAGGAGCCAGGCCACCCCGTCACCCTGTTCGGAGATTGATACCGTGGGAACGGCGC
CCTCTTCACCGATCTCGGTCACCCTGGAGCCCCCGGAGCCGCATCTTGTGACAGACGGACCCCA
GCATCACCATCACCTCCACCACGGCCAACAGCCACCGCCACCGTCCGCGCCCCCCGCGCAAAGT
TTGCAGCCTTCTCCCCAACAGCAACCGCCGCCGCAGCCGCAGTCTGCAGCCCAGCAACTGGGCT
CGGCCGCCGCGGCCCCCAGGACTTCCACCTCTTCCTTTTTAATTAAGGACATCTTGGGAGACAG
CAAACCCCTGGCGGCTTGTGCACCCTACAGCACCAGCGTTTCTTCTCCTCATCACACCCCGAAG
CAGGAGTGCAACGCGGCGCACGAGAGCTTCAGGCCAAAGCTGGAGCAGGAGGACAGCAAAACCA
AGCTGGACAAGAGGGAAGACTCTCAGAGCGACATCAAATGCCACGGAACAAAGGAGGAAGGAGA
CCGGGAGATTACAAGTAGCCGAGAGAGTCCCCCTGTGAGAGCCAAGAAACCTCGAAAGGCCAGG
ACAGCTTTCTCGGACCACCAGCTCAATCAACTGGAACGTAGCTTTGAGCGGCAGAAGTACCTCA
GTGTACAGGACCGCATGGACCTGGCAGCTGCACTCAACCTCACTGATACCCAAGTCAAGACCTG
GTACCAGAACCGCAGAACCAAGTGGAAGCGGCAGACTGCAGTGGGCCTGGAGTTGCTTGCCGAG
GCGGGGAACTACTCCGCGCTGCAGAGGATGTTTCCGTCGCCTTATTTCTACCACCCAAGCCTGC
TGGGGAGCATGGACAGCACGACGGCGGCCGCGGCGGCCGCGGCAATGTACAGCAGCATGTACCG
AACTCCTCCTGCACCCCATCCGCAGCTGCAGCGGCCACTGGTGCCCCGCGTGCTCATCCACGGC
CTGGGGCCTGGGGGACAGCCGGCCCTCAACCCTTTGTCCAACCCCATCCCAGGCACCCCGCATC
CCCGGTGAGGAAGGAGGGACAGTGCAGCCCGAGCAGCCCTCCAGGTTTCCACCCGGCCGCCGAC
AGCTGCCCCACCTCTCCCCGCACCAAACCAACAGGAATAGAGGCAGACGAGTAAAGGGGGGGAG
CTCACCGGTGGGCTGGGTCCCCAAGGACCGGCCAGCCCTCTGTTCTCCATCTGCCCCCTCAGAG
GCAGGGCCGCAAAGCTCCCCAACAGTGTGACTGGAGAAAATACTGACCCCACTGAAAGTGCAAC
CAGTAAGTGAAAACACCCACCCACCCACCCACCCACACACACACACAAAATGAACCCTCGAGTT
CTTTCTTTCTTTCTTTTTTTTTTTTTTTGAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_075245	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA32474	(Get FASTA)	NCBI Sequence Viewer
	EDL83949	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002887
	ENSRNOP00000002887.2
GenBank Protein	O88181	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_075245 ⟸ NM_022956

- UniProtKB:

O88181 (UniProtKB/Swiss-Prot), A6KPL6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTAMEGASGSSFGIDTILSGAGSGSPGMMNGDFRSLGEARTTDFRSQATPSPCSEIDTVGTAPS
SPISVTLEPPEPHLVTDGPQHHHHLHHGQQPPPPSAPPAQSLQPSPQQQPPPQPQSAAQQLGSA
AAAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQECNAAHESFRPKLEQEDSKTKL
DKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSV
QDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLG
SMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRVLIHGLGPGGQPALNPLSNPIPGTPHPR

hide sequence

Ensembl Acc Id:

ENSRNOP00000002887 ⟸ ENSRNOT00000002887

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88181-F1-model_v2	AlphaFold	O88181	1-384	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620726	AgrOrtholog
BioCyc Gene	G2FUF-16570	BioCyc
Ensembl Genes	ENSRNOG00000002117	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002887	ENTREZGENE
	ENSRNOT00000002887.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Homeobox_metazoa	UniProtKB/Swiss-Prot
	Homeobox_TF	UniProtKB/Swiss-Prot
KEGG Report	rno:65050	UniProtKB/Swiss-Prot
NCBI Gene	65050	ENTREZGENE
PANTHER	HOMEO BOX HB9 LIKE A-RELATED	UniProtKB/Swiss-Prot
	VENT HOMEOBOX	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
PhenoGen	Barhl2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002117	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
UniProt	A6KPL6	ENTREZGENE, UniProtKB/TrEMBL
	BARH2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Barhl2	BarH-like homeobox 2	Barhl2	BarH-like 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Barhl2	BarH-like 2 (Drosophila)	LOC65050	BarH-class homeodomain transcription factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-08-07	Loc65050	BarH-class homeodomain transcription factor			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	involved in neural differentiation

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message