Atp6v0e2 (ATPase, H+ transporting V0 subunit e2)

Gene: Atp6v0e2 (ATPase, H+ transporting V0 subunit e2) Rattus norvegicus

Analyze

Symbol:

Atp6v0e2

Name:

ATPase, H+ transporting V0 subunit e2

RGD ID:

1303238

Description:

Predicted to enable proton-transporting ATPase activity, rotational mechanism. Predicted to be involved in synaptic vesicle lumen acidification. Is active in synaptic vesicle membrane. Orthologous to human ATP6V0E2 (ATPase H+ transporting V0 subunit e2); PARTICIPATES IN oxidative phosphorylation pathway; phagocytosis pathway; rheumatoid arthritis pathway; INTERACTS WITH 17beta-estradiol; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATPase, H+ transporting, lysosomal V0 subunit E2; ATPase, H+ transporting, V0 subunit; ATPase, H+ transporting, V0 subunit E; ATPase, H+ transporting, V0 subunit E isoform 2; NM9.2; V-ATPase subunit e 2; V-type proton ATPase subunit e 2; vacuolar proton pump subunit e 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP6V0E2 (ATPase H+ transporting V0 subunit e2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Atp6v0e2 (ATPase, H+ transporting, lysosomal V0 subunit E2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp6v0e2 (ATPase H+ transporting V0 subunit e2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP6V0E2 (ATPase H+ transporting V0 subunit e2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP6V0E2 (ATPase H+ transporting V0 subunit e2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp6v0e2 (ATPase H+ transporting V0 subunit e2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103227203 (V-type proton ATPase subunit e 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp6v0e2 (ATPase H+ transporting V0 subunit e2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATP6V0E1 (ATPase H+ transporting V0 subunit e1)	HGNC	OrthoDB
Homo sapiens (human):	RASD2 (RASD family member 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Atp6v0e2 (ATPase, H+ transporting, lysosomal V0 subunit E2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATP6V0E2 (ATPase H+ transporting V0 subunit e2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atpv0e2 (ATPase H+ transporting V0 subunit e2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VMA9	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	VhaM9.7-b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vha-17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	VhaM9.7-a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	VhaM9.7-c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	VhaM9.7-d	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	atp6v0e2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	78,815,771 - 78,818,919 (+)	NCBI		GRCr8
mRatBN7.2	4	77,484,868 - 77,488,016 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	77,482,226 - 77,488,777 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	82,692,160 - 82,695,320 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	78,467,664 - 78,470,824 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	76,907,939 - 76,911,099 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	78,168,117 - 78,171,265 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	78,168,117 - 78,171,265 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	142,831,814 - 142,834,962 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	76,621,828 - 76,624,976 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	76,897,957 - 76,901,106 (+)	NCBI
Celera	4	72,422,401 - 72,425,549 (+)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP,ISO)

gallic acid (ISO)

heptachlor (EXP)

indometacin (EXP)

L-methionine (ISO)

levofloxacin (EXP)

methamphetamine (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

monocrotaline (ISO)

N-nitrosodiethylamine (EXP)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

parathion (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (EXP)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proton transmembrane transport (ISO)

synaptic vesicle lumen acidification (ISO)

transmembrane transport (IBA)

Cellular Component

clathrin-coated vesicle membrane (IEA)

synaptic vesicle membrane (EXP,IDA,IEP)

vacuolar proton-transporting V-type ATPase, V0 domain (ISS)

Molecular Function

proton-transporting ATPase activity, rotational mechanism (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

oxidative phosphorylation pathway (IEA)

phagocytosis pathway (IEA)

rheumatoid arthritis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Structure of V-ATPase from the mammalian brain.	Abbas YM, etal., Science. 2020 Mar 13;367(6483):1240-1246. doi: 10.1126/science.aaz2924.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	A novel putative M9.2 isoform of V-ATPase expressed in the nervous system.	Ueda T, etal., Neuroreport 2003 Jan 20;14(1):25-30.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:17350184

Genomics

Comparative Map Data

Atp6v0e2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	78,815,771 - 78,818,919 (+)	NCBI		GRCr8
mRatBN7.2	4	77,484,868 - 77,488,016 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	77,482,226 - 77,488,777 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	82,692,160 - 82,695,320 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	78,467,664 - 78,470,824 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	76,907,939 - 76,911,099 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	78,168,117 - 78,171,265 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	78,168,117 - 78,171,265 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	142,831,814 - 142,834,962 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	76,621,828 - 76,624,976 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	76,897,957 - 76,901,106 (+)	NCBI
Celera	4	72,422,401 - 72,425,549 (+)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

ATP6V0E2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	149,872,964 - 149,880,713 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	149,872,968 - 149,891,204 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	149,570,053 - 149,577,802 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	149,200,990 - 149,208,720 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	144,239,268 - 144,246,884 (+)	NCBI		Celera
Cytogenetic Map	7	q36.1	NCBI
HuRef	7	143,645,461 - 143,653,226 (+)	NCBI		HuRef
CHM1_1	7	149,578,636 - 149,586,366 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	151,055,071 - 151,062,678 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	148,908,071 - 148,915,657 (+)	NCBI

Atp6v0e2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	48,514,503 - 48,518,735 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	48,514,549 - 48,518,735 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	48,537,569 - 48,541,801 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	48,537,615 - 48,541,801 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	48,487,568 - 48,491,800 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	48,467,201 - 48,471,384 (+)	NCBI		MGSCv36	mm8
Celera	6	49,048,231 - 49,052,496 (+)	NCBI		Celera
Cytogenetic Map	6	B2.3	NCBI
cM Map	6	23.52	NCBI

Atp6v0e2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955491	4,929,405 - 4,935,247 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955491	4,929,405 - 4,935,247 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP6V0E2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	186,428,253 - 186,444,842 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	38,438,514 - 38,448,734 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	141,575,549 - 141,584,844 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	154,047,799 - 154,057,326 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	154,047,799 - 154,057,320 (+)	Ensembl	panpan1.1		panPan2

ATP6V0E2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	14,642,090 - 14,646,956 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	14,642,200 - 14,646,145 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	15,250,781 - 15,257,193 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	16,356,998 - 16,363,411 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	16	14,736,943 - 14,743,356 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	15,317,851 - 15,324,263 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	15,368,517 - 15,374,931 (+)	NCBI		UU_Cfam_GSD_1.0

Atp6v0e2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	6,979,066 - 6,985,093 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936527	5,917,742 - 5,925,299 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936527	5,918,347 - 5,924,395 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC103227203
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	118,438,435 - 118,446,060 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	118,439,143 - 118,444,214 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	14,398,002 - 14,405,722 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp6v0e2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624800	6,156,364 - 6,164,455 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624800	6,160,091 - 6,164,426 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp6v0e2
22 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	398
Count of miRNA genes:	209
Interacting mature miRNAs:	258
Transcripts:	ENSRNOT00000010853
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	77356721	77687411	Rat

Markers in Region

RH134533

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	77,488,522 - 77,488,713 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	78,171,772 - 78,171,962	NCBI	Rnor6.0
Rnor_5.0	4	142,835,469 - 142,835,659	UniSTS	Rnor5.0
RGSC_v3.4	4	76,625,483 - 76,625,673	UniSTS	RGSC3.4
Celera	4	72,426,056 - 72,426,246	UniSTS
RH 3.4 Map	4	490.1	UniSTS
Cytogenetic Map	4	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	18	41	8	11	74	35	36	11	8
Low					1						5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001002253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB566985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB584357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB757317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010853 ⟹ ENSRNOP00000010853

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	77,482,226 - 77,488,777 (+)	Ensembl
Rnor_6.0 Ensembl	4	78,168,117 - 78,171,265 (+)	Ensembl

RefSeq Acc Id:

NM_001002253 ⟹ NP_001002253

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	78,815,771 - 78,818,919 (+)	NCBI
mRatBN7.2	4	77,484,868 - 77,488,016 (+)	NCBI
Rnor_6.0	4	78,168,117 - 78,171,265 (+)	NCBI
Rnor_5.0	4	142,831,814 - 142,834,962 (+)	NCBI
RGSC_v3.4	4	76,621,828 - 76,624,976 (+)	RGD
Celera	4	72,422,401 - 72,425,549 (+)	RGD

Sequence:

show sequence

GCCCGGACGTGCACCTGCTTAGAGAGTCCTCCGTTCGATCCGGTACCCCGTCTGAGCATCGTGC
ACCCAGCCATGACAGCCCATTCCTTTGCCCTTCCTGTCATCATCTTCACCACATTCTGGGGCCT
CATCGGCATCGCTGGGCCCTGGTTCGTGCCCAAAGGACCCAACCGTGGGGTGATCATCACCATG
CTGGTAGCTACTGCTGTCTGCTGTTACCTCTTCTGGCTCATCGCCATCTTGGCCCAGCTGAACC
CCCTATTTGGGCCACAGCTGAAGAATGAGACCATCTGGTACGTGCGCTTCCTGTGGGAGTGACC
ACTGGGAGTGACCGGCTGGCTTCTGGCCCCAGATGCCCTGCTGTGAAAGATGACCCAGCCTTGA
TGTCCCTGGAGACCCTGCATTCCCACTGGCCCCACCCATCAGTATGACGTTCTGTGCTCTCCGT
GCCAGCGTGCTGTGGGATCCATACCCCCCAGAGCCAACCTGGTTTCAGTTTCCCCTGTGTTCCC
AGCCATTAGGGGGCCTCCATTTTGGGAAAACCCTGTGCTTAGTCAGGACACAGTGGGGGCTAAC
CTGAGCTCAAATCCCCACACTTGGCACTTCTCTCTCTTCCAAGCAGATCCTGGCTGAGAAGCTG
GACCTGCTGGGATCTGTTTTCATCCAGGGAGCAGAAGGCAGGACTCAGCCTGGTCCCAGAAAGG
ACTCAAGTCTTTGTGGAGAAGGGACATGTGGCCCAGAACACTCCAAGCTTTTCAACTCTTGCCT
CCACTGTGTTGAAATATTGGGTCAGGGTCACAGGCCTCCTCCAGCCCTGAAGTGGATTACCCAT
TTAGTTTCTTGCACTTCTAGATGTGAAATT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001002253	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89958	(Get FASTA)	NCBI Sequence Viewer
	EDL88262	(Get FASTA)	NCBI Sequence Viewer
	EDL88263	(Get FASTA)	NCBI Sequence Viewer
	EDL88264	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010853
	ENSRNOP00000010853.3
	ENSRNOP00055039570
	ENSRNOP00060041475
	ENSRNOP00065019534
GenBank Protein	Q5EB76	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001002253 ⟸ NM_001002253
- UniProtKB:	Q5EB76 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLF GPQLKNETIWYVRFLWE hide sequence

RefSeq Acc Id:

ENSRNOP00000010853 ⟸ ENSRNOT00000010853

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5EB76-F1-model_v2	AlphaFold	Q5EB76	1-81	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693024

Promoter ID:

EPDNEW_R3547

Type:

initiation region

Name:

Atp6v0e2_1

Description:

ATPase, H+ transporting V0 subunit e2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	78,168,101 - 78,168,161	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303238	AgrOrtholog
BioCyc Gene	G2FUF-44956	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000008218	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055027760	UniProtKB/Swiss-Prot
	ENSRNOG00060028617	UniProtKB/Swiss-Prot
	ENSRNOG00065015082	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010853	ENTREZGENE
	ENSRNOT00000010853.7	UniProtKB/Swiss-Prot
	ENSRNOT00055048070	UniProtKB/Swiss-Prot
	ENSRNOT00060049747	UniProtKB/Swiss-Prot
	ENSRNOT00065024964	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7312897	IMAGE-MGC_LOAD
InterPro	ATPase_V0-cplx_e1/e2_su	UniProtKB/Swiss-Prot
	ATPase_V0-cplx_e1/e2_su_met	UniProtKB/Swiss-Prot
KEGG Report	rno:436582	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109294	IMAGE-MGC_LOAD
NCBI Gene	436582	ENTREZGENE
PANTHER	PTHR12263	UniProtKB/Swiss-Prot
	V-TYPE PROTON ATPASE SUBUNIT E 2	UniProtKB/Swiss-Prot
Pfam	ATP_synt_H	UniProtKB/Swiss-Prot
PhenoGen	Atp6v0e2	PhenoGen
PIRSF	V-ATP_synth_e1/e2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008218	RatGTEx
	ENSRNOG00055027760	RatGTEx
	ENSRNOG00060028617	RatGTEx
	ENSRNOG00065015082	RatGTEx
UniProt	A6K0F4_RAT	UniProtKB/TrEMBL
	A6K0F6_RAT	UniProtKB/TrEMBL
	Q5EB76	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-25	Atp6v0e2	ATPase, H+ transporting V0 subunit e2	Atp6v0e2	ATPase, H+ transporting, lysosomal V0 subunit E2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Atp6v0e2	ATPase, H+ transporting, lysosomal V0 subunit E2	Atp6v0e2	ATPase, H+ transporting, V0 subunit E isoform 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-05-19	Atp6v0e2	ATPase, H+ transporting, V0 subunit E isoform 2	NM9.2	ATPase, H+ transporting, V0 subunit	Symbol and Name updated to reflect official family nomenclature	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in retina; expressed exclusively in brain in mice	1303955

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways