Advanced Search (OLGA)

Gene: Atg4c (autophagy related 4C, cysteine peptidase) Rattus norvegicus

Analyze

Symbol:

Atg4c

Name:

autophagy related 4C, cysteine peptidase

RGD ID:

1598323

Description:

Predicted to enable cysteine-type endopeptidase activity and protein-phosphatidylethanolamide deconjugating activity. Predicted to be involved in macroautophagy and protein processing. Predicted to be active in cytoplasm. Orthologous to human ATG4C (autophagy related 4C cysteine peptidase); PARTICIPATES IN autophagy pathway; INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATG4 autophagy related 4 homolog C; ATG4 autophagy related 4 homolog C (S. cerevisiae); autophagy-related 4C; autophagy-related 4C (yeast); cysteine protease ATG4C; LOC313391; similar to APG4 autophagy 4 homolog C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATG4C (autophagy related 4C cysteine peptidase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atg4c (autophagy related 4C, cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atg4c (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATG4C (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATG4C (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atg4c (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATG4C (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATG4C (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atg4c (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atg4c (autophagy related 4C cysteine peptidase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATG4C (autophagy related 4C cysteine peptidase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ATG4C (autophagy related 4C cysteine peptidase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atg4c (autophagy related 4C, cysteine peptidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atg4c (autophagy related 4C, cysteine peptidase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atg4c (autophagy related 4C, cysteine peptidase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atg4c (autophagy related 4C, cysteine peptidase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATG4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATG4	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Atg4b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Atg4b	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atg-4.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	atg-4.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atg4c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atg4c	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	118,982,918 - 119,052,695 (+)	Ensembl				GRCr8
mRatBN7.2	5	113,867,218 - 113,935,534 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	113,867,092 - 113,934,830 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	116,432,880 - 116,500,736 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	118,158,223 - 118,226,079 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	118,220,766 - 118,288,622 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	117,861,517 - 117,932,116 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	117,877,594 - 117,931,003 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	121,801,802 - 121,868,749 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	119,844,905 - 119,892,804 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	112,422,843 - 112,490,885 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Crohn's disease (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

chrysene (ISO)

clorgyline (ISO)

copper(II) sulfate (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

ethanol (ISO)

FR900359 (ISO)

gentamycin (EXP)

lipopolysaccharide (ISO)

lycopene (ISO)

methapyrilene (EXP)

microcystin-LR (ISO)

N-acetyl-L-cysteine (ISO)

oxaliplatin (EXP)

paraquat (ISO)

potassium chromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

Soman (EXP)

tetrachloromethane (EXP,ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aggrephagy (IBA)

autophagosome assembly (IBA,IEA,ISO)

autophagy (IEA,ISO)

biological_process (ND)

mitophagy (IBA)

piecemeal microautophagy of the nucleus (IBA)

protein delipidation (ISO)

protein processing (IBA)

protein transport (IEA)

proteolysis (IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA)

Molecular Function

cysteine-type endopeptidase activity (IBA,IEA,ISO)

cysteine-type peptidase activity (IEA,ISO)

hydrolase activity (IEA)

peptidase activity (IEA)

protein binding (ISO)

protein-phosphatidylethanolamide deconjugating activity (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

autophagy pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation
4.	LC3 conjugation system in mammalian autophagy.	Tanida I, etal., Int J Biochem Cell Biol. 2004 Dec;36(12):2503-18.

Additional References at PubMed

PMID:21177865

Genomics

Comparative Map Data

Atg4c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	118,982,918 - 119,052,695 (+)	Ensembl				GRCr8
mRatBN7.2	5	113,867,218 - 113,935,534 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	113,867,092 - 113,934,830 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	116,432,880 - 116,500,736 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	118,158,223 - 118,226,079 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	118,220,766 - 118,288,622 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	117,861,517 - 117,932,116 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	117,877,594 - 117,931,003 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	121,801,802 - 121,868,749 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	119,844,905 - 119,892,804 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	112,422,843 - 112,490,885 (+)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

ATG4C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	62,784,132 - 62,865,516 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	62,783,821 - 62,865,999 (+)	Ensembl			hg38	GRCh38
GRCh37	1	63,249,803 - 63,331,187 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	63,022,391 - 63,102,638 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	61,538,646 - 61,618,912 (+)	NCBI		Celera
Cytogenetic Map	1	p31.3	NCBI
HuRef	1	61,361,473 - 61,442,355 (+)	NCBI		HuRef
CHM1_1	1	63,364,721 - 63,446,306 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	62,662,283 - 62,743,647 (+)	NCBI		T2T-CHM13v2.0

Atg4c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	99,077,181 - 99,185,495 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	99,082,171 - 99,148,024 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	99,189,159 - 99,297,258 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	99,193,934 - 99,259,787 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	98,860,625 - 98,926,478 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	98,685,952 - 98,751,805 (+)	NCBI		MGSCv36	mm8
Celera	4	97,573,659 - 97,639,877 (+)	NCBI		Celera
Cytogenetic Map	4	C6	NCBI
cM Map	4	45.61	NCBI

Atg4c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	26,928,147 - 26,993,308 (-)	Ensembl
ChiLan1.0	NW_004955423	26,813,865 - 26,993,308 (-)	NCBI	ChiLan1.0	ChiLan1.0

ATG4C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	163,986,661 - 164,069,230 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	163,136,882 - 163,219,437 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	62,041,948 - 62,123,866 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	63,856,245 - 63,937,514 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	63,856,511 - 63,937,514 (+)	Ensembl			panPan2	panpan1.1

ATG4C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	47,273,387 - 47,359,452 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	47,188,816 - 47,359,402 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	47,335,099 - 47,420,547 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	47,456,697 - 47,542,055 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	47,282,556 - 47,541,955 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	47,412,900 - 47,497,781 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	47,358,502 - 47,443,312 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	47,621,837 - 47,707,196 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Atg4c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	76,123,956 - 76,216,742 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936692	439,280 - 532,657 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936692	439,475 - 532,633 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATG4C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	149,608,220 - 149,692,153 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	149,560,318 - 149,691,959 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	137,803,114 - 137,886,707 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATG4C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	70,209,536 - 70,291,750 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	70,208,716 - 70,291,718 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	47,164,447 - 47,276,287 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atg4c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	31,060,376 - 31,127,740 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624742	31,061,869 - 31,130,786 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atg4c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	55,261,444 - 55,333,988 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Atg4c
426 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	47
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000011631
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	84630798	129630798	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1298077	Bp157	Blood pressure QTL 157			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	114474223	121056531	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	84630798	129630798	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1582212	Livw2	Liver weight QTL 2	3.5	0.0004	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	5	104018576	124314782	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84630798	129630798	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
1600362	Mcs19	Mammary carcinoma susceptibility QTL 19	2.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	82032155	127032155	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011631 ⟹ ENSRNOP00000011631

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	118,982,918 - 119,050,888 (+)	Ensembl
mRatBN7.2 Ensembl	5	113,886,811 - 113,934,830 (+)	Ensembl
Rnor_6.0 Ensembl	5	117,877,594 - 117,931,003 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104305 ⟹ ENSRNOP00000076527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	118,982,937 - 119,052,695 (+)	Ensembl
mRatBN7.2 Ensembl	5	113,867,092 - 113,934,830 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115804 ⟹ ENSRNOP00000095805

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	113,887,109 - 113,934,830 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116538 ⟹ ENSRNOP00000084390

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	118,982,918 - 119,043,463 (+)	Ensembl
mRatBN7.2 Ensembl	5	113,867,218 - 113,934,824 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000146775 ⟹ ENSRNOP00000106807

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	119,002,289 - 119,052,695 (+)	Ensembl

RefSeq Acc Id:

NM_001107948 ⟹ NP_001101418

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,982,699 - 119,050,298 (+)	NCBI
mRatBN7.2	5	113,867,218 - 113,934,824 (+)	NCBI
Rnor_6.0	5	117,862,746 - 117,931,520 (+)	NCBI
Rnor_5.0	5	121,801,802 - 121,868,749 (+)	NCBI
RGSC_v3.4	5	119,844,905 - 119,892,804 (+)	RGD
Celera	5	112,422,843 - 112,490,885 (+)	RGD

Sequence:

show sequence

GTAGTCCGAGACCGCAGGAGCTCACGGTGCGTGGCGGCTGGTAGCTGAAGTGCAGTAGTTACAG
CTACGAGGGACAGCTGTAATCCTAACACAGGCCTACCGCTCACAAATACACGGCGCTAGGCTCT
GAGCTTGCAGCCTGGGAGCTTAGGGTCTCGGACAGGGCTATCTTCAGGACCGCGGCCTACGGAG
GCTTCGGAGTCCTGTGCTACGGTGGCCGCGCAGGGCCGCGTGCCGCACGTCCCGCGGTGCGTAC
GCGCTGTTCCGAGCGGCTGCTGGAGCCTGAGCGTGTGCTGGTGTGCGGACTCCTGCGCAGCAGT
ACAGTTATTCAGTCCTGTGTCGCCGAGGGGATCGCTTGAGGCTGGCGGAGTGGAGAAGTACATT
GGATTTTCTAAAAGAATGGAATCAAGTGATGGCTTTTTCTTTAGAATTTGAATATGGAGGCGTC
AGGAACAGATGAAGTTGACAAGCTAAAAACTAAATTTATATCTGCTTGGAACAACATGAAATAT
AGTTGGGTGTTGAAAACAAAGACATATTTTAGTAGAAACTCACCTGTTTTATTGCTTGGAAAAT
GTTATCATTTTAAATATGAAGATGAAAGCAAGGTGTTGCCCGCAAGATCAGGATGTGCCATTGA
AGATCATGTAATTGCAGGCAATGTGGAAGAGTTCCGTAAGGATTTCATTTCTAGAATATGGCTG
ACCTACAGGGAAGAATTTCCTCAAATAGAAGCTTCAGCCTTGACGACAGACTGTGGCTGGGGCT
GTACACTGCGGACCGGCCAGATGCTGCTGGCTCAGGGACTCATACTACATTTTCTCGGTAGAGC
CTGGACCTGGCCCGACGCACTGCACATTGAGAGTTCGGACTCCGACTCATGGACCTCCAACACC
ATCCACAAGTTCACTGCGTCCTTTGAAGCCTCCCTTTCAGGGGAGAGAGAACTCCGGACCCCAG
CAGTCTCTCTGAAGGAAACGTCCGGGAAGCATCCCGACGACCATGCAGTACAGAGTGAGATTTA
CCACAGGCAGATCATCTCTTGGTTTGGAGACTCCCCTGTGGCTGTCTTTGGCTTACATCGCCTG
ATAGAGTTCGGGAAGAAGTCTGGGAAGAAAGCTGGTGACTGGTATGGACCAGCAGTGGTTGCTC
ACATTTTAAGAAAAGCAGTTGAAGAAGCAAGGCATCCGGATTTGCAAGGGCTAACAATTTATGT
TGCCCAGGACTGTACAGTTTACAATTCTGATGTAATTGATAAGCAGACTGATTCTGTGACGGCT
GGAGATGCTCGTGACAAGGCTGTTATTATTTTAGTTCCTGTTAGGCTTGGTGGAGAAAGAACCA
ACATTGACTATCTGGAGTTTGTGAAGGGTGTTTTAAGCCTTGAGTATTGTGTTGGTATCATTGG
CGGCAAACCGAAACAGTCATACTACTTTGCTGGATTTCAAGATGACAGTTTGATTTACATGGAT
CCTCATTACTGCCAGTCTTTTGTAGATGTCAGCATAAAGGATTTCCCTCTCGAGACATTCCACT
GTCCATCTCCTAAGAAGATGTCATTTCGAAAAATGGATCCTAGTTGCACGATAGGATTTTACTG
TCGAAATGTCCAGGACTTTGAACGAGCATCTGAAGAAATCACTAAGATGTTGAAAATTTCCTCT
AAGGAGAAATATCCATTATTTACTTTTGTAAATGGCCATTCCAGAGACTTTGATTTTACGTCCA
CTGCAGCCAGTGAGGAAGACCTTTTCTTAGAAGATGAAAAGAAGAATTTCAAAAGATTTAGCAC
AGAAGAGTTTGTCCTCCTTTAAAGGTGAAGACATTTGTGCTTCTGAGAAGTGCTTGAGCACAGT
GGAGTCGAAAAGAGCAACGAGCGAGCTGGAGATCCTCACTAAGCACGTCCCTTTAACAGTGCAC
ATTCGAACACACCTAGACTTTAAAGGTATTTTTCTGAATACCTTTTCTAAACGACTTGATGGCT
CTTGCTTTCCAGTGATAAATAACAAGCTATTCTGGTTGCATTCCTGTTTCCCAAAGATGTGCTA
ATGGAACACTACATAAACTGCAAGCCTTTCGGTCCCCAGCATTTTCTACCTGAGCCCATTGATC
CCCTGAAGGTTTTATGATATATGTTTCCTCCAAGATTCAGATCACCAAGTTACTTTTAAAAGCC
TCACTTTGTATTGATGACAGGAGACTGGATCTTCAGCGCTACCCAACCTCCTGCTCTCACTGTA
ACCAGAGGATGTTTTGGGTTTATGTATCTGGATAATAAAATGGACACATAAAATTATATAAGCA
GGATTTTAAGGCAGTACTTAACAATGT

hide sequence

RefSeq Acc Id:

XM_039109911 ⟹ XP_038965839

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI
mRatBN7.2	5	113,867,239 - 113,935,417 (+)	NCBI

RefSeq Acc Id:

XM_039109912 ⟹ XP_038965840

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI
mRatBN7.2	5	113,878,849 - 113,935,417 (+)	NCBI

RefSeq Acc Id:

XM_039109913 ⟹ XP_038965841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI
mRatBN7.2	5	113,867,239 - 113,935,417 (+)	NCBI

RefSeq Acc Id:

XM_039109914 ⟹ XP_038965842

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,049,729 (+)	NCBI
mRatBN7.2	5	113,867,238 - 113,934,279 (+)	NCBI

RefSeq Acc Id:

XM_039109915 ⟹ XP_038965843

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,050,894 (+)	NCBI
mRatBN7.2	5	113,867,238 - 113,935,534 (+)	NCBI

RefSeq Acc Id:

XM_039109916 ⟹ XP_038965844

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,015,683 (+)	NCBI
mRatBN7.2	5	113,867,238 - 113,900,206 (+)	NCBI

RefSeq Acc Id:

XM_063287652 ⟹ XP_063143722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	118,977,594 - 119,015,683 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101418	(Get FASTA)	NCBI Sequence Viewer
	XP_038965839	(Get FASTA)	NCBI Sequence Viewer
	XP_038965840	(Get FASTA)	NCBI Sequence Viewer
	XP_038965841	(Get FASTA)	NCBI Sequence Viewer
	XP_038965842	(Get FASTA)	NCBI Sequence Viewer
	XP_038965843	(Get FASTA)	NCBI Sequence Viewer
	XP_038965844	(Get FASTA)	NCBI Sequence Viewer
	XP_063143722	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL97808	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011631
	ENSRNOP00000011631.8
	ENSRNOP00000076527
	ENSRNOP00000076527.1
	ENSRNOP00000084390
	ENSRNOP00000084390.2
	ENSRNOP00000106807
	ENSRNOP00000106807.1

RefSeq Acc Id:

NP_001101418 ⟸ NM_001107948

- UniProtKB:

A0A8I5ZXZ8 (UniProtKB/TrEMBL), A6JRL6 (UniProtKB/TrEMBL), F1M3M0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEASGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDESKVLPARSG
CAIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEASALTTDCGWGCTLRTGQMLLAQGLILHF
LGRAWTWPDALHIESSDSDSWTSNTIHKFTASFEASLSGERELRTPAVSLKETSGKHPDDHAVQ
SEIYHRQIISWFGDSPVAVFGLHRLIEFGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGL
TIYVAQDCTVYNSDVIDKQTDSVTAGDARDKAVIILVPVRLGGERTNIDYLEFVKGVLSLEYCV
GIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTI
GFYCRNVQDFERASEEITKMLKISSKEKYPLFTFVNGHSRDFDFTSTAASEEDLFLEDEKKNFK
RFSTEEFVLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000011631 ⟸ ENSRNOT00000011631

RefSeq Acc Id:	XP_038965843 ⟸ XM_039109915
- Peptide Label:	isoform X4
- UniProtKB:	F1M3M0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965842 ⟸ XM_039109914
- Peptide Label:	isoform X3
- UniProtKB:	F1M3M0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965844 ⟸ XM_039109916
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038965839 ⟸ XM_039109911
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZXZ8 (UniProtKB/TrEMBL), A6JRL6 (UniProtKB/TrEMBL), F1M3M0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965841 ⟸ XM_039109913
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5Y0E2 (UniProtKB/TrEMBL), A0A8I6AKI4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038965840 ⟸ XM_039109912
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZXZ8 (UniProtKB/TrEMBL), A6JRL6 (UniProtKB/TrEMBL), F1M3M0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000095805 ⟸ ENSRNOT00000115804

Ensembl Acc Id:

ENSRNOP00000084390 ⟸ ENSRNOT00000116538

Ensembl Acc Id:

ENSRNOP00000076527 ⟸ ENSRNOT00000104305

RefSeq Acc Id:	XP_063143722 ⟸ XM_063287652
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000106807 ⟸ ENSRNOT00000146775

Protein Domains

Peptidase C54 catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M3M0-F1-model_v2	AlphaFold	F1M3M0	1-455	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1598323	AgrOrtholog
BioCyc Gene	G2FUF-40577	BioCyc
Ensembl Genes	ENSRNOG00000008767	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011631	ENTREZGENE
	ENSRNOT00000011631.8	UniProtKB/TrEMBL
	ENSRNOT00000104305	ENTREZGENE
	ENSRNOT00000104305.2	UniProtKB/TrEMBL
	ENSRNOT00000116538	ENTREZGENE
	ENSRNOT00000116538.2	UniProtKB/TrEMBL
	ENSRNOT00000146775	ENTREZGENE
	ENSRNOT00000146775.1	UniProtKB/TrEMBL
InterPro	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Peptidase_C54	UniProtKB/TrEMBL
	Peptidase_C54_cat	UniProtKB/TrEMBL
KEGG Report	rno:313391	UniProtKB/TrEMBL
NCBI Gene	313391	ENTREZGENE
PANTHER	Peptidase_C54	UniProtKB/TrEMBL
	PTHR22624:SF38	UniProtKB/TrEMBL
Pfam	Peptidase_C54	UniProtKB/TrEMBL
PhenoGen	Atg4c	PhenoGen
RatGTEx	ENSRNOG00000008767	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A0A8I5Y0E2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZXZ8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKI4	ENTREZGENE
	A0ABK0LX96_RAT	UniProtKB/TrEMBL
	A6JRL6	ENTREZGENE, UniProtKB/TrEMBL
	F1M3M0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-06-07	Atg4c	autophagy related 4C, cysteine peptidase	Atg4c	ATG4 autophagy related 4 homolog C (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Atg4c	ATG4 autophagy related 4 homolog C (S. cerevisiae)	Atg4c	autophagy-related 4C (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Atg4c	autophagy-related 4C (yeast)	LOC313391	similar to APG4 autophagy 4 homolog C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC313391	similar to APG4 autophagy 4 homolog C			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)