Advanced Search (OLGA)

Gene: Scg3 (secretogranin III) Rattus norvegicus

Analyze

Symbol:

Scg3

Name:

secretogranin III

RGD ID:

621209

Description:

Predicted to be involved in protein localization to secretory granule. Predicted to be located in extracellular region and transport vesicle membrane. Predicted to be active in secretory granule membrane. Orthologous to human SCG3 (secretogranin III); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1B1075; secretogranin-3; SgIII

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SCG3 (secretogranin III)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Scg3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Scg3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SCG3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SCG3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Scg3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SCG3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SCG3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Scg3 (secretogranin III)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SCG3 (secretogranin III)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Scg3 (secretogranin III)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scg3 (secretogranin III)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	scg3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	85,280,253 - 85,322,484 (-)	NCBI		GRCr8
mRatBN7.2	8	76,399,777 - 76,442,015 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	76,399,777 - 76,442,015 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	81,907,241 - 81,955,800 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	80,172,086 - 80,214,605 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	78,006,582 - 78,055,133 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	82,582,352 - 82,641,536 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	82,582,352 - 82,641,536 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	82,183,497 - 82,242,336 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	80,467,921 - 80,514,192 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	80,495,390 - 80,533,246 (-)	NCBI
Celera	8	76,189,600 - 76,231,758 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

developmental and epileptic encephalopathy 13 (ISO)

Metabolic Syndrome (ISO)

paraplegia (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

cyclophosphamide (ISO)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

flavonoids (EXP)

fulvestrant (ISO)

lead(0) (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nitrofen (EXP)

panobinostat (ISO)

paraquat (ISO)

potassium dichromate (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XL147 (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein localization to secretory granule (IBA,IEA,ISO)

Cellular Component

extracellular region (IEA)

secretory granule membrane (IBA,IEA,ISO)

transport vesicle membrane (IEA)

Molecular Function

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Primary structure of mouse secretogranin III and its absence from deficient mice.	Dopazo A, etal., J Mol Neurosci 1993 Winter;4(4):225-33.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Identification of a chromogranin A domain that mediates binding to secretogranin III and targeting to secretory granules in pituitary cells and pancreatic beta-cells.	Hosaka M, etal., Mol Biol Cell. 2002 Oct;13(10):3388-99.
4.	Association of variations in the FTO, SCG3 and MTMR9 genes with metabolic syndrome in a Japanese population.	Hotta K, etal., J Hum Genet. 2011 Sep;56(9):647-51. doi: 10.1038/jhg.2011.74. Epub 2011 Jul 28.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:2204688	PMID:14597614	PMID:15125023	PMID:16219686	PMID:18483175	PMID:18802106	PMID:22658674

Genomics

Comparative Map Data

Scg3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	85,280,253 - 85,322,484 (-)	NCBI		GRCr8
mRatBN7.2	8	76,399,777 - 76,442,015 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	76,399,777 - 76,442,015 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	81,907,241 - 81,955,800 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	80,172,086 - 80,214,605 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	78,006,582 - 78,055,133 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	82,582,352 - 82,641,536 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	82,582,352 - 82,641,536 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	82,183,497 - 82,242,336 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	80,467,921 - 80,514,192 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	80,495,390 - 80,533,246 (-)	NCBI
Celera	8	76,189,600 - 76,231,758 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

SCG3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	51,681,503 - 51,721,026 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	51,681,492 - 51,721,026 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	51,973,700 - 52,013,223 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	49,760,842 - 49,800,515 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	49,760,841 - 49,800,514	NCBI
Celera	15	28,866,950 - 28,906,642 (+)	NCBI		Celera
Cytogenetic Map	15	q21.2	NCBI
HuRef	15	28,804,039 - 28,843,731 (+)	NCBI		HuRef
CHM1_1	15	52,091,646 - 52,131,257 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	49,488,960 - 49,528,517 (+)	NCBI		T2T-CHM13v2.0

Scg3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	75,550,648 - 75,591,733 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	75,550,471 - 75,591,338 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	75,643,366 - 75,685,959 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	75,643,189 - 75,684,056 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	75,491,173 - 75,531,863 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	75,429,283 - 75,469,926 (-)	NCBI		MGSCv36	mm8
Celera	9	72,806,816 - 72,848,434 (-)	NCBI		Celera
Cytogenetic Map	9	D	NCBI
cM Map	9	42.32	NCBI

Scg3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	2,875,017 - 2,907,363 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	2,876,355 - 2,907,363 (-)	NCBI	ChiLan1.0	ChiLan1.0

SCG3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	40,915,374 - 40,955,246 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	45,095,846 - 45,135,710 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	30,619,990 - 30,658,668 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	48,950,839 - 48,989,481 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	48,950,839 - 48,989,481 (+)	Ensembl	panpan1.1		panPan2

SCG3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	17,373,924 - 17,406,632 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	17,308,591 - 17,406,646 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	17,235,828 - 17,333,023 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	17,454,894 - 17,552,842 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	17,454,273 - 17,555,486 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	17,376,485 - 17,474,260 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	17,495,281 - 17,592,525 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	17,601,119 - 17,699,155 (+)	NCBI		UU_Cfam_GSD_1.0

Scg3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	95,666,009 - 95,704,416 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	13,514,073 - 13,555,139 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	13,514,072 - 13,552,250 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCG3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	120,045,309 - 120,138,260 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	120,045,302 - 120,090,035 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	133,136,325 - 133,181,057 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCG3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	31,655,789 - 31,693,585 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	31,654,094 - 31,693,535 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	109,520,872 - 109,560,174 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scg3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	8,650,631 - 8,681,923 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	8,652,648 - 8,681,905 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Scg3
402 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	264
Count of miRNA genes:	176
Interacting mature miRNAs:	191
Transcripts:	ENSRNOT00000014491
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	75311777	84531599	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	75311938	82925521	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat

Markers in Region

AI547406

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	76,399,881 - 76,400,126 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	82,582,457 - 82,582,701	NCBI	Rnor6.0
Rnor_5.0	8	82,183,602 - 82,183,846	UniSTS	Rnor5.0
RGSC_v3.4	8	80,468,026 - 80,468,270	UniSTS	RGSC3.4
Celera	8	76,189,705 - 76,189,949	UniSTS
RH 3.4 Map	8	901.28	UniSTS
Cytogenetic Map	8	q24	UniSTS

Scg3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	76,399,783 - 76,399,881 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	82,582,359 - 82,582,456	NCBI	Rnor6.0
Rnor_5.0	8	82,183,504 - 82,183,601	UniSTS	Rnor5.0
RGSC_v3.4	8	80,467,928 - 80,468,025	UniSTS	RGSC3.4
Celera	8	76,189,607 - 76,189,704	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	47	113	79	78	47	25	47	6	202	94	93	44	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U02983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014491 ⟹ ENSRNOP00000014491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	76,399,777 - 76,442,015 (-)	Ensembl
Rnor_6.0 Ensembl	8	82,582,352 - 82,641,536 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099204 ⟹ ENSRNOP00000088677

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	76,399,777 - 76,441,722 (-)	Ensembl

RefSeq Acc Id:

NM_053856 ⟹ NP_446308

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	85,280,253 - 85,322,484 (-)	NCBI
mRatBN7.2	8	76,399,777 - 76,442,015 (-)	NCBI
Rnor_6.0	8	82,582,352 - 82,641,536 (-)	NCBI
Rnor_5.0	8	82,183,497 - 82,242,336 (-)	NCBI
RGSC_v3.4	8	80,467,921 - 80,514,192 (-)	RGD
Celera	8	76,189,600 - 76,231,758 (-)	RGD

Sequence:

show sequence

GTAGAGTAAAGCTACGCCCAGGCCCGCGTCCGCAGGCGACGCAGGAACTTCAGCACCCGCGGGG
CGGACAGCGCCCGCCGCACCTGCTCACCTGCTCCGGGCGCCGGAAGAGCCCACATCCTCCTGCC
AGCCCCGTGAGACTGCCACCGGGGGCCGCCCAGATCCTCTCCCTTCCTGCACCCAGGCTCCTGT
CCCTTCCAGCTTCTTACTCCCCTTCTCATTCATAACAAAAGCTACAGCTCAGGGGCCCAGCGCC
AAGCTCTTTCCAGCAGAGCGCAGAGGAGCAAGAAAGAATGGGGTTCCTTTGGACAGGCTCTTGG
ATACTGGTGTTGGTGCTCAACAGCGGCCCAATTCAAGCTTTCCCCAAACCCGAAGGCAGCCAAG
ACAAATCCCTGCATAATAGAGAATTGAGTGCAGAGAGACCCTTGAATGAGCAGATCGCTGAGGC
AGAGGCAGACAAGATTAAAAAGACATACCCCTCAGAAAGCAAGCCAAGTGAAAGCAATTTTTCT
TCGGTCGATAACTTGAATCTGCTAAAGGCGATAACGGAAAAGGAAACAGTTGAGAAAGCCAAGC
AATCCATAAGAAGCTCCCCGTTTGATAACAGACTGAATGTGGACGATGCCGATTCAACTAAAAA
TCGGAAGCTGACCGACGAGTACGACTCCACTAAGAGTGGACTGGACCGCAAGGTTCAAGATGAC
CCAGATGGCCTCCATCAACTGGATGGAACTCCTTTAACTGCTGAAGACATTGTCCATAAAATTG
CCACCAGGATTTATGAGGAGAACGACAGAGGAGTGTTTGACAAGATTGTCTCTAAACTGCTGAA
TCTCGGCCTAATCACTGAAAGCCAGGCACATACTCTAGAAGATGAAGTAGCAGAGGCTTTACAA
AAATTGATTTCAAAAGAGGCCAACAATTATGAGGAGGCCCCGGAAAAACCCACAAGCAGGACCG
AGAATCAGGATGGGAAAATACCGGAGAAAGTGACTCCAGTGGCAGCAACCCAAGATGGCTTTAC
TAACCGTGAAAATGATGACACAGTATCGAACACCTTGACCTTGTCCAACGGCTTGGAAAGGAGA
ACGAACCCCCACAGGGACGATGACTTTGAGGAGCTCCAGTATTTCCCCAACTTCTATGCACTAC
TGACAAGCATCGACTCAGAAAAAGAAGCAAAAGAGAAAGAAACCCTGATCACCATCATGAAGAC
GTTGATTGACTTTGTGAAAATGATGGTGAAATACGGTACAATATCTCCAGAGGAAGGCGTTTCT
TACCTTGAAAACTTGGATGAAACCATTGCTCTGCAGACCAAGAACAAGCTAGAAAAAAATACCA
CTGACAGCAAAAGCAAGCTTTTCCCAGCTCCGCCAGAGAAGAGTCACGAAGAAACAGACAGTAC
CAAGGAGGAAGCCGCCAAGATGGAGAAGGAATACGGAAGCCTCAAAGACTCCACAAAAGACGAT
AACTCCAACCTCGGAGGAAAGACAGATGAAGCCAAAGGGAAAACAGAAGCCTACTTGGAAGCCA
TTAGAAAAAACATCGAGTGGCTGAAGAAGCACAACAAGAAGGGCAACAAAGAAGATTACGACCT
TTCAAAGATGAGGGACTTCATCAACCAACAGGCTGATGCTTATGTGGAGAAAGGCATCCTGGAT
AAGGAAGAAGCCAACGCCATCAAACGCATCTACAGCAGCCTGTGAAAACGGCAGGCAACCTGAG
CCTTCCAACTGTTCCAGCAAAAACAATATAGCTTAAAATCTAATTCGGCGGTTAAAGATTTATC
AGCCCAGGAGTCTTAGGATGTGCTGACTTTATAGTAGTTAATCCCTTAGAAATGAGTAAAATAG
AGCTCTCTTGCCATAAACACCTTATGAAAGGTAAAGTTGTAAAGAGCCTCGGTTTTTCTATGTA
GAATCCTTAATCCTTATTTCCTCTTGGATTTACATTTTATAATCAGAGATATGCTGTTCTGGAA
GAGACTCTGATGGGTTGAACATACATCTGAACCTACTTCCCACTGTCGTCAGCCCTGTTTCGGC
ATGCTAGACACCTGAGCACATCGTTGGATGTTTGTTATTTGATGCTGTTTCCAGTAGTTCTCTG
TTGGGCACGGAAATAAACCCACGTCTCTTCAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_446308	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA56637	(Get FASTA)	NCBI Sequence Viewer
	EDL77778	(Get FASTA)	NCBI Sequence Viewer
	EDL77779	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014491.6
	ENSRNOP00000088677.1
GenBank Protein	P47868	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446308 ⟸ NM_053856

- Peptide Label:

precursor

- Sequence:

show sequence

MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSE
SKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKS
GLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTL
EDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTL
TLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYG
TISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYG
SLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQAD
AYVEKGILDKEEANAIKRIYSSL

hide sequence

Ensembl Acc Id:

ENSRNOP00000014491 ⟸ ENSRNOT00000014491

Ensembl Acc Id:

ENSRNOP00000088677 ⟸ ENSRNOT00000099204

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P47868-F1-model_v2	AlphaFold	P47868	1-471	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696132

Promoter ID:

EPDNEW_R6657

Type:

single initiation site

Name:

Scg3_1

Description:

secretogranin III

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	82,641,550 - 82,641,610	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621209	AgrOrtholog
BioCyc Gene	G2FUF-29810	BioCyc
Ensembl Genes	ENSRNOG00000010784	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014491.7	UniProtKB/TrEMBL
	ENSRNOT00000099204.1	UniProtKB/TrEMBL
InterPro	SCG3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:116635	UniProtKB/Swiss-Prot
NCBI Gene	116635	ENTREZGENE
PANTHER	PTHR17388	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SECRETOGRANIN-3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SGIII	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Scg3	PhenoGen
RatGTEx	ENSRNOG00000010784	RatGTEx
UniProt	A0A8I6AAD7_RAT	UniProtKB/TrEMBL
	A6I1E8_RAT	UniProtKB/TrEMBL
	A6I1E9_RAT	UniProtKB/TrEMBL
	F1M7L6_RAT	UniProtKB/TrEMBL
	P47868	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Scg3	secretogranin III			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Scg3	secretogranin III			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of the granin family	634042
gene_protein	421 amino acids	634042

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar