Ppp2r1a (protein phosphatase 2 scaffold subunit A alpha)

Advanced Search (OLGA)

Gene: Ppp2r1a (protein phosphatase 2 scaffold subunit A alpha) Rattus norvegicus

Analyze

Symbol:

Ppp2r1a

Name:

protein phosphatase 2 scaffold subunit A alpha

RGD ID:

620907

Description:

Predicted to enable several functions, including protein antigen binding activity; protein heterodimerization activity; and protein phosphatase regulator activity. Predicted to be involved in several processes, including T cell homeostasis; negative regulation of intracellular signal transduction; and protein dephosphorylation. Predicted to act upstream of or within several processes, including nuclear division; peptidyl-serine dephosphorylation; and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand. Predicted to be located in several cellular components, including chromosome, centromeric region; lateral plasma membrane; and neuronal cell body. Predicted to be part of FAR/SIN/STRIPAK complex and protein phosphatase type 2A complex. Predicted to be active in cytosol; glutamatergic synapse; and nucleus. Human ortholog(s) of this gene implicated in autosomal dominant intellectual developmental disorder 36. Orthologous to human PPP2R1A (protein phosphatase 2 scaffold subunit Aalpha); PARTICIPATES IN phosphatidylinositol 3-kinase-Akt signaling pathway; platelet-derived growth factor signaling pathway; Chagas disease pathway; INTERACTS WITH (R)-adrenaline; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha isoform of regulatory subunit A, protein phosphatase 2; MGC95083; PR65; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform; protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; protein phosphatase 2, regulatory subunit A, alpha; serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI		GRCr8
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	65,329,720 - 65,348,961 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	74,024,287 - 74,043,556 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	67,239,755 - 67,258,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	58,458,861 - 58,463,770 (+)	NCBI
Celera	1	56,683,597 - 56,702,854 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

autosomal dominant intellectual developmental disorder 36 (ISO)

brachydactyly (ISO)

Breast Neoplasms (ISO)

Colorectal Neoplasms (ISO)

Disease Progression (ISO)

gastric adenocarcinoma (ISO)

genetic disease (ISO)

head and neck squamous cell carcinoma (ISO)

intellectual disability (ISO)

lung adenocarcinoma (ISO)

microcephaly (ISO)

Muscle Hypotonia (ISO)

Neurodevelopmental Disorders (ISO)

osteoarthritis (ISO)

osteogenesis imperfecta (ISO)

ovarian serous cystadenocarcinoma (ISO)

prostate adenocarcinoma (ISO)

stereotypic movement disorder (ISO)

Stomach Neoplasms (ISO)

uterine cancer (ISO)

uterine carcinosarcoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(R)-adrenaline (EXP)

(Z)-3-butylidenephthalide (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-dinitrotoluene (EXP)

2-bromohexadecanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-aza-2'-deoxycytidine (ISO)

7H-xanthine (EXP)

9H-xanthine (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

atrazine (ISO)

benzene (EXP,ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

chlorogenic acid (ISO)

chlorpyrifos (ISO)

clobetasol (ISO)

clozapine (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

decabromodiphenyl ether (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenpyroximate (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

haloperidol (EXP)

hypochlorous acid (ISO)

ivermectin (ISO)

lead(0) (ISO)

lovastatin (ISO)

methidathion (ISO)

miconazole (ISO)

microcystin RR (ISO)

microcystin-LR (EXP,ISO)

N-Vinyl-2-pyrrolidone (EXP)

nefazodone (EXP)

nickel sulfate (ISO)

niclosamide (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

pyrazinecarboxamide (EXP)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

warfarin (ISO)

WIN 55212-2 (ISO)

zinc atom (EXP)

zinc sulfate (ISO)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromosome segregation (IBA,ISO)

female meiotic nuclear division (ISO)

meiotic sister chromatid cohesion, centromeric (ISO)

meiotic spindle elongation (ISO)

mitotic sister chromatid separation (ISO)

negative regulation of hippo signaling (ISO)

negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

peptidyl-serine dephosphorylation (ISO)

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (ISO)

regulation of meiotic cell cycle process involved in oocyte maturation (ISO)

T cell homeostasis (ISO)

Cellular Component

chromosome, centromeric region (ISO)

cytoplasm (IBA)

cytosol (IBA,ISO)

FAR/SIN/STRIPAK complex (ISO)

glutamatergic synapse (ISO)

lateral plasma membrane (ISO)

neuron projection (ISO)

neuronal cell body (ISO)

nucleus (IBA,ISO)

protein phosphatase type 2A complex (IBA,ISO)

synapse (ISO)

Molecular Function

protein antigen binding (ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein phosphatase regulator activity (IBA)

protein serine/threonine phosphatase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

hepatitis C pathway (IEA)

long term depression (IEA)

mRNA decay pathway (IEA)

phosphatidylinositol 3-kinase-Akt signaling pathway (ISO)

platelet-derived growth factor signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of PP2A B regulatory subunit beta isotype in rat testis.	Hatano Y, etal., FEBS Lett 1993 Jun 7;324(1):71-5.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Phosphatase: PP2A structural importance, regulation and its aberrant expression in cancer.	Seshacharyulu P, etal., Cancer Lett. 2013 Jul 10;335(1):9-18. doi: 10.1016/j.canlet.2013.02.036. Epub 2013 Feb 20.

Additional References at PubMed

PMID:9847399	PMID:12477932	PMID:12885400	PMID:12944463	PMID:16452087	PMID:16580887	PMID:16717086	PMID:17055435	PMID:17174897	PMID:22871113	PMID:23533145	PMID:24413018
PMID:24465463	PMID:24899574	PMID:30611118

Genomics

Comparative Map Data

Ppp2r1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI		GRCr8
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	65,329,720 - 65,348,961 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	74,024,287 - 74,043,556 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	67,239,755 - 67,258,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	58,458,861 - 58,463,770 (+)	NCBI
Celera	1	56,683,597 - 56,702,854 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

PPP2R1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	52,190,052 - 52,229,518 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	52,170,936 - 52,229,518 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	52,693,305 - 52,732,771 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	57,385,046 - 57,421,483 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	57,385,045 - 57,421,482	NCBI
Celera	19	49,742,609 - 49,779,232 (+)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	49,023,481 - 49,060,103 (+)	NCBI		HuRef
CHM1_1	19	52,694,941 - 52,731,564 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	55,277,246 - 55,316,713 (+)	NCBI		T2T-CHM13v2.0

Ppp2r1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	21,165,716 - 21,186,167 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	21,165,573 - 21,186,178 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	20,945,454 - 20,965,905 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	20,945,311 - 20,965,916 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	21,082,418 - 21,102,869 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	20,650,151 - 20,670,602 (+)	NCBI		MGSCv36	mm8
Celera	17	21,977,995 - 21,998,451 (+)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI
cM Map	17	11.4	NCBI

Ppp2r1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955558	381,794 - 410,485 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955558	381,794 - 410,485 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP2R1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	58,232,259 - 58,268,655 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	60,156,718 - 60,193,105 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	49,133,295 - 49,169,447 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	58,011,383 - 58,047,577 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	58,011,383 - 58,047,577 (+)	Ensembl	panpan1.1		panPan2

PPP2R1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	104,974,059 - 105,013,745 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	104,974,072 - 105,013,663 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	104,546,959 - 104,586,647 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	105,482,896 - 105,522,584 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	105,481,754 - 105,522,572 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	105,155,353 - 105,195,079 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	104,809,802 - 104,849,707 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	105,597,164 - 105,636,892 (-)	NCBI		UU_Cfam_GSD_1.0

Ppp2r1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	3,866,510 - 3,896,513 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936901	622,888 - 653,044 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936901	622,893 - 653,044 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP2R1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	57,921,329 - 57,964,961 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	57,929,520 - 57,964,948 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	52,233,180 - 52,268,640 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP2R1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,990,402 - 45,026,210 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	44,990,367 - 45,026,227 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	25,047,701 - 25,083,506 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp2r1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	2,979,320 - 3,011,715 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	2,979,270 - 3,009,189 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppp2r1a
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	61
Interacting mature miRNAs:	66
Transcripts:	ENSRNOT00000015019
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

BF390652

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	60,548,767 - 60,549,625 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	60,725,930 - 60,726,787	NCBI	Rnor6.0
Rnor_5.0	1	61,892,542 - 61,893,399	UniSTS	Rnor5.0
RGSC_v3.4	1	58,450,763 - 58,451,620	UniSTS	RGSC3.4
Celera	1	56,692,156 - 56,693,013	UniSTS
RH 3.4 Map	15	328.88	UniSTS
Cytogenetic Map	1	q12	UniSTS

Ppp2r1b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	84,259,139 - 84,259,515 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	92,488,389 - 92,488,764	NCBI	Rnor6.0
Rnor_5.0	7	93,130,340 - 93,130,715	UniSTS	Rnor5.0
RGSC_v3.4	7	89,259,069 - 89,259,444	UniSTS	RGSC3.4
Celera	7	81,099,995 - 81,100,370	UniSTS
Cytogenetic Map	7	q31	UniSTS
Cytogenetic Map	1	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015019 ⟹ ENSRNOP00000015019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	60,540,194 - 60,560,129 (+)	Ensembl
Rnor_6.0 Ensembl	1	60,717,386 - 60,736,609 (+)	Ensembl

RefSeq Acc Id:

NM_057140 ⟹ NP_476481

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	69,213,198 - 69,232,441 (+)	NCBI
mRatBN7.2	1	60,540,223 - 60,559,467 (+)	NCBI
Rnor_6.0	1	60,717,386 - 60,736,629 (+)	NCBI
Rnor_5.0	1	61,883,998 - 61,903,241 (+)	NCBI
RGSC_v3.4	1	58,442,220 - 58,461,462 (+)	RGD
Celera	1	56,683,597 - 56,702,854 (+)	RGD

Sequence:

show sequence

GATGGCAGCTGCCGACGGCGACGATTCGCTCTACCCCATTGCGGTGCTCATAGATGAACTGCGC
AATGAGGACGTTCAGCTTCGTCTCAATAGTATCAAGAAGCTCTCCACCATTGCCTTGGCCCTTG
GGGTTGAACGGACCAGAAGTGAGCTCCTGCCCTTTCTTACAGATACCATCTATGATGAAGATGA
GGTCCTCTTGGCTTTGGCTGAACAGCTGGGAACCTTCACCACTTTGGTGGGAGGACCCGAGTAT
GTGCACTGTCTGCTGCCACCTCTTGAGTCACTGGCCACAGTGGAAGAGACAGTAGTGCGAGACA
AGGCGGTAGAATCCTTGCGGGCCATCTCTCATGAGCACTCACCTTCCGATCTAGAGGCTCACTT
TGTGCCTCTGGTGAAGCGGCTGGCGGGTGGAGACTGGTTCACCTCCCGTACCTCAGCCTGTGGT
CTCTTCTCAGTTTGCTACCCCCGAGTATCCAGTGCCGTGAAGGCAGAACTTCGACAGTACTTCC
GGAACCTGTGCTCAGATGATACCCCCATGGTGCGGCGGGCCGCTGCCTCCAAGCTGGGGGAGTT
TGCCAAGGTACTGGAGCTGGACAATGTCAAGAGTGAGATCATTCCCATGTTCTCTAACCTGGCC
TCTGACGAGCAGGACTCGGTGCGGCTGCTGGCAGTAGAGGCATGCGTGAATATCGCCCAGCTTC
TGCCCCAGGAGGACCTGGAGGCCTTAGTGATGCCCACCTTGCGACAGGCTGCTGAGGACAAGTC
TTGGCGTGTCCGCTACATGGTGGCAGACAAATTCACAGAGCTCCAGAAAGCAGTTGGGCCTGAG
ATCACTAAGACAGATCTGGTGCCTGCCTTCCAGAACCTGATGAAAGACTGTGAGGCCGAGGTGA
GGGCCGCAGCCTCCCACAAGGTCAAAGAGTTCTGTGAAAATCTCTCAGCTGACTGCCGGGAGAA
TGTGATCATGACCCAGATCTTGCCCTGCATCAAGGAACTCGTGTCCGATGCCAACCAACATGTC
AAGTCAGCACTGGCTTCAGTCATCATGGGCCTCTCTCCCATTCTGGGCAAAGACAATACCATCG
AACACCTCTTGCCCCTGTTCTTGGCTCAGCTGAAGGATGAGTGTCCTGAGGTGCGGCTGAACAT
CATTTCCAACCTGGATTGTGTGAATGAAGTGATTGGCATCCGGCAGCTCTCGCAGTCCTTGCTT
CCTGCCATCGTGGAACTCGCTGAAGATGCCAAGTGGCGAGTGCGGCTGGCCATCATTGAATACA
TGCCTCTGCTGGCTGGACAGCTCGGTGTGGAATTTTTTGATGAGAAACTTAACTCTTTGTGTAT
GGCCTGGCTAGTGGATCATGTCTATGCTATCCGTGAGGCTGCCACCAGCAACCTTAAGAAGCTA
GTGGAGAAGTTCGGGAAGGAGTGGGCCCATGCCACTATCATCCCCAAGGTCTTAGCCATGTCTG
GAGACCCTAACTACCTGCACCGAATGACTACACTCTTCTGCATCAATGTGTTGTCTGAGGTCTG
TGGGCAGGATATTACCACGAAGCACATGCTGCCCACAGTTCTTCGTATGGCTGGGGACCCAGTC
GCCAATGTCCGCTTCAATGTGGCCAAGTCACTACAGAAGATAGGACCCATTCTTGATAACAGCA
CCCTGCAAAGTGAAGTCAAGCCTATCCTAGAGAAGCTGACCCAGGACCAGGATGTGGATGTCAA
GTACTTTGCCCAGGAGGCTCTGACTGTTCTCTCTCTTGCCTGATGCTGGAAGAAGAAGCATTGC
CGGCCTCTGGTGTCCACCCTCCAACCCCCACAGTTACCTCCCTTAGGGAGGTGGTGGGAGCAAA
TGACTGTCGCTCCCGTGCATGGTCTGACCCCAGGCCCCTCCCTCAGCACGGTTTGGTTTCTCCT
CTCTGTAGCCTGGGAAGACTTCTCTGTCCACCTCCTGCGGGGCTGGGGCAGTACAAGTTGGGGC
AGGACAGCAGCCTGAAAAGAAGGTCTGGTTGTTCCTGCCCATATTGGGAGAGATGGGAGCATCC
TAGGTCACTGGCTTTTGCTGCTGTAATGGGGACCCCCCTCCCCCATCTACTTACAAGCACCCTT
TCCTAACCCCAACCATGTTTTTTTGTGTGTGTCAATTGTGCCATTTTTATTTTATTCCTTTCCC
TACTCTTTACACAGAATAAAAATGTAGAAATAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_476481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83859	(Get FASTA)	NCBI Sequence Viewer
	BAA21903	(Get FASTA)	NCBI Sequence Viewer
	EDL99781	(Get FASTA)	NCBI Sequence Viewer
	EDL99782	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015019.4

RefSeq Acc Id:

NP_476481 ⟸ NM_057140

- UniProtKB:

Q5XI34 (UniProtKB/TrEMBL), F7EWM3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDE
VLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHF
VPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEF
AKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKS
WRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCREN
VIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNI
ISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCM
AWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVC
GQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVK
YFAQEALTVLSLA

hide sequence

Ensembl Acc Id:

ENSRNOP00000015019 ⟸ ENSRNOT00000015019

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI34-F1-model_v2	AlphaFold	Q5XI34	1-589	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689651

Promoter ID:

EPDNEW_R176

Type:

initiation region

Name:

Ppp2r1a_1

Description:

protein phosphatase 2 scaffold subunit A alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	60,717,308 - 60,717,368	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620907	AgrOrtholog
BioCyc Gene	G2FUF-61200	BioCyc
Ensembl Genes	ENSRNOG00000011282	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015019.7	UniProtKB/TrEMBL
Gene3D-CATH	1.25.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7126254	IMAGE-MGC_LOAD
InterPro	ARM-like	UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/TrEMBL
	HEAT	UniProtKB/TrEMBL
	HEAT_type_2	UniProtKB/TrEMBL
	PP2A_Regulatory_Subunit_A	UniProtKB/TrEMBL
KEGG Report	rno:117281	UniProtKB/TrEMBL
MGC_CLONE	MGC:95083	IMAGE-MGC_LOAD
NCBI Gene	117281	ENTREZGENE
PANTHER	PTHR10648:SF2	UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN PHOSPHATASE PP2A 65 KDA REGULATORY SUBUNIT	UniProtKB/TrEMBL
Pfam	HEAT	UniProtKB/TrEMBL
	HEAT_2	UniProtKB/TrEMBL
	PPP2R1A-like_HEAT	UniProtKB/TrEMBL
PhenoGen	Ppp2r1a	PhenoGen
PROSITE	HEAT_REPEAT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011282	RatGTEx
Superfamily-SCOP	ARM-type_fold	UniProtKB/TrEMBL
UniProt	A6KB84_RAT	UniProtKB/TrEMBL
	F7EWM3	ENTREZGENE, UniProtKB/TrEMBL
	Q5XI34	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-18	Ppp2r1a	protein phosphatase 2 scaffold subunit A alpha	Ppp2r1a	protein phosphatase 2, regulatory subunit A, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Ppp2r1a	protein phosphatase 2, regulatory subunit A, alpha	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Ppp2r1a	protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)