Advanced Search (OLGA)

Gene: Gimd1 (GIMAP family P-loop NTPase domain containing 1) Rattus norvegicus

Analyze

Symbol:

Gimd1

Name:

GIMAP family P-loop NTPase domain containing 1

RGD ID:

1563706

Description:

Predicted to enable GTPase activity. Orthologous to human GIMD1 (GIMAP family P-loop NTPase domain containing 1); INTERACTS WITH 4,4'-diaminodiphenylmethane; bisphenol A; bromobenzene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GIMAP family P-loop NTPase domain-containing protein 1; GTPase IMAP family member GIMD1; hypothetical protein LOC362042; LOC362042; RGD1563706; similar to Zgc:92184; uncharacterized protein LOC362042

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	223,777,876 - 223,812,582 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	223,777,889 - 223,812,576 (+)	Ensembl				GRCr8
mRatBN7.2	2	221,103,878 - 221,138,559 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	221,103,878 - 221,138,553 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	228,763,140 - 228,797,778 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	226,662,817 - 226,697,456 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	221,520,476 - 221,555,112 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	237,679,672 - 237,714,434 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	237,679,792 - 237,714,428 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	256,220,243 - 256,255,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	230,094,670 - 230,129,331 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	213,339,932 - 213,374,624 (+)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

arsenous acid (ISO)

bisphenol A (EXP)

bromobenzene (EXP)

diarsenic trioxide (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

furan (EXP)

indole-3-methanol (EXP)

metformin (EXP)

orphenadrine (EXP)

paracetamol (ISO)

phenformin (EXP)

rotenone (EXP,ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

GTP binding (IEA)

GTPase activity (IBA)

nucleotide binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Gimd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	223,777,876 - 223,812,582 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	223,777,889 - 223,812,576 (+)	Ensembl				GRCr8
mRatBN7.2	2	221,103,878 - 221,138,559 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	221,103,878 - 221,138,553 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	228,763,140 - 228,797,778 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	226,662,817 - 226,697,456 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	221,520,476 - 221,555,112 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	237,679,672 - 237,714,434 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	237,679,792 - 237,714,428 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	256,220,243 - 256,255,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	230,094,670 - 230,129,331 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	213,339,932 - 213,374,624 (+)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

GIMD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	106,357,392 - 106,368,778 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	106,357,392 - 106,368,778 (-)	Ensembl			hg38	GRCh38
GRCh37	4	107,278,549 - 107,289,935 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Celera	4	104,578,559 - 104,702,257 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI
HuRef	4	103,014,021 - 103,023,272 (-)	NCBI		HuRef
CHM1_1	4	107,256,271 - 107,265,531 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	109,668,465 - 109,679,852 (-)	NCBI		T2T-CHM13v2.0

Gimd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	132,335,607 - 132,353,543 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	132,335,581 - 132,351,112 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	132,629,846 - 132,647,782 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	132,629,820 - 132,645,351 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	132,297,707 - 132,307,613 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	132,572,031 - 132,581,955 (+)	NCBI		MGSCv36	mm8
Celera	3	139,063,357 - 139,073,263 (+)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	61.47	NCBI

Gimd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955496	3,049,859 - 3,060,961 (+)	Ensembl
ChiLan1.0	NW_004955496	3,049,862 - 3,060,961 (+)	NCBI	ChiLan1.0	ChiLan1.0

GIMD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	104,455,715 - 104,469,260 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	104,750,996 - 104,764,528 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	98,838,222 - 98,849,590 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	109,445,476 - 109,456,055 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	109,445,476 - 109,456,055 (-)	Ensembl			panPan2	panpan1.1

GIMD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	27,110,706 - 27,123,098 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	27,112,388 - 27,121,704 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	14,903,728 - 14,916,557 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	27,342,023 - 27,354,854 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	27,344,140 - 27,354,846 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	27,335,951 - 27,348,772 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	27,081,545 - 27,094,374 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	12,766,149 - 12,778,980 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gimd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	14,055,813 - 14,066,244 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936814	773,090 - 782,948 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936814	773,090 - 782,948 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GIMD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	115,413,722 - 115,428,342 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	115,410,731 - 115,428,396 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	123,809,413 - 123,828,069 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GIMD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	54,350,087 - 54,362,590 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	54,350,223 - 54,359,393 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	32,983,184 - 32,993,161 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gimd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624830	2,604,307 - 2,614,408 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624830	2,604,307 - 2,614,707 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gimd1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	26,264,745 - 26,299,539 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gimd1
881 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	79
Count of miRNA genes:	64
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000064628
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	212145502	231732847	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	205135267	225627153	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
1302789	Stl26	Serum triglyceride level QTL 26	3.1	0.0035	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	206613059	226891081	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
1359019	Hrtrt19	Heart rate QTL 19	2.9		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221270493	228950743	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat

Markers in Region

D2Rat362

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	221,122,010 - 221,122,274 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	237,697,886 - 237,698,149	NCBI	Rnor6.0
Rnor_5.0	2	256,238,405 - 256,238,668	UniSTS	Rnor5.0
RGSC_v3.4	2	230,112,763 - 230,113,027	RGD	RGSC3.4
RGSC_v3.4	2	230,112,764 - 230,113,027	UniSTS	RGSC3.4
Celera	2	213,358,066 - 213,358,329	UniSTS
RGSC_v3.1	2	230,099,503 - 230,099,767	RGD
SHRSP x BN Map	2	91.9898	RGD
SHRSP x BN Map	2	91.9898	UniSTS
Cytogenetic Map	2	q43	UniSTS

D2Rat292

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	221,122,010 - 221,122,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	237,697,886 - 237,698,150	NCBI	Rnor6.0
Rnor_5.0	2	256,238,405 - 256,238,669	UniSTS	Rnor5.0
RGSC_v3.4	2	230,112,763 - 230,113,028	RGD	RGSC3.4
RGSC_v3.4	2	230,112,764 - 230,113,028	UniSTS	RGSC3.4
Celera	2	213,358,066 - 213,358,330	UniSTS
RGSC_v3.1	2	230,099,453 - 230,099,840	RGD
SHRSP x BN Map	2	93.1498	RGD
SHRSP x BN Map	2	93.1498	UniSTS
Cytogenetic Map	2	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	6	16	40	67	64	39	24	39	5	180	59	1	25	66	37	25	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001113782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064628 ⟹ ENSRNOP00000060170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	223,777,889 - 223,812,576 (+)	Ensembl
mRatBN7.2 Ensembl	2	221,103,878 - 221,138,553 (+)	Ensembl
Rnor_6.0 Ensembl	2	237,679,792 - 237,714,428 (+)	Ensembl

RefSeq Acc Id:

NM_001113782 ⟹ NP_001107254

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	223,777,899 - 223,812,582 (+)	NCBI
mRatBN7.2	2	221,103,878 - 221,138,559 (+)	NCBI
Rnor_6.0	2	237,679,751 - 237,714,434 (+)	NCBI
Rnor_5.0	2	256,220,243 - 256,255,429 (+)	NCBI
RGSC_v3.4	2	230,094,670 - 230,129,331 (+)	RGD
Celera	2	213,339,932 - 213,374,624 (+)	NCBI

Sequence:

show sequence

AAATGGTCCTCAGGAGGTCAGTGATCTCATAGTCATTGGAGGTTCACCTTGTTTGAAAGTAGTT
TTGACCTCTTACCATTGTTGTGTGACACTATTTCTAGGAAGAAGTGAGCAAATATCTTCTCACC
TCAGAGAGGGAGCCGATAAGAGAGCAAGTAGAAATACCACTAAAGTCCAACATAGTGAGTCAAC
TGTGTTATTGGTATTAGTTAGTGTAATGTGGATGAGGGTTTATTTCCTGCAACAGAAATGACTC
GAAGACAGCTGCATTACTCCAACATGAGTGACAACGCGGGGCATACTGCACAACTTGCAGGTTC
TTAAAAGCTATGATGGACGCCAACAAGATGATCATCAATTTGGCTGTCCTTGGCAAGACTCAGA
GTGGGAAAAGTTCTGCTGGGAACGTTCTTTTGGGGAGTGCTGACTTCTACAGCAGGTTTGCTCC
AGGTTCTGTAACCAAAGATTGCAGCCTGGGTCGCAGTTGTCATATCCATGGCTTCATGCGTCGA
GGAGGACACGAGATTAGTTTGCAGATACAGGTATTGGACACTCCAGGGTATCCACACAGCAAGC
TGAGCACGAGATGTGTAAAACAGGAAGTAAAGAAGGCCTTGGAGCATCACTTTGGACAAGAGGG
TCTCCATCTTGCTCTGCTGGTCCATAGAGCTGATATGCCTTTCTTCGGACAGGAAGCATCTGAC
TCAGTCCAATTGATTCAGGAACTTCTGGGAGATTCTTGGAAGAACTACACCGCTATTCTTTTTA
CCCATGCAGAAAAAATCAAAGAGGCTGGGTTAAGCGAAGAGGAATATTTGTGCGAGGCTTCTGA
CGCACTGTTAACCTTGCTAAATTCTGTTCAGCACAGACATATTTTCCTATATGAAAGAGGAAAC
TCATGGAGTGAACAAAGAATTAAAATCTTAGAAAGAATCATGGAATTTATAAAAGAAAATCATT
TTCAAGTTCTTAGTTTTACATAAAGTTTAAGTGAAAAGAAGAGGGCACTGGTTATCAATCAGGG
ACTGATATCCGATTTTAAAATCTGGGGCAGGAGAATTCCCTGTACAGCCATTGAGTCATTTTGG
AAAAAAATTGTAAATAAAAACTAATATTAAGGATTCAAGATTTCATGATATCAGAGTTATACTC
ACAAGTATTTATCCAACAGAAAAGTGTGCACTTGTGCATTTAGACACATGCATATACAAGAATG
TCCATGGTGGTACCATTGAGCATAGCTGAAGACTGAAAACTATCTAAATGCTCATTTAGAATAA
TATTCAAATTGTGGTAATTTAACCCACTGACATGTACAGTGTGAGAATGGACAAGCTCACTCTC
CTGTAATAGCAGCTATCAACTACCTAAGTAGAATGCCAAGAGAACGAAGCACAGAAACTGTGCT
CAATGGTTCCATTTGTATAACGACCAGAGACAAAGACCAGTGCAACTCTCTTCTAGTGCAGAGA
AACGCTGGGCATCAGCAAAGTCACAGGATGCTGTGGGATGGCCGCAGAGGTGTTGGCAAGGCTA
TTTCCCGATTTGGAAACCGGTTTCATTTGGATGTCTACCTTGTAAAATGGAACAAAATTTCCTG
TAATGTATGAGCTCATAACGATATTTGGGAATATAATTGCGAATGAATAAAAGATTTTTAAAAG
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102722 ⟹ XP_038958650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	223,777,886 - 223,812,582 (+)	NCBI
mRatBN7.2	2	221,104,066 - 221,138,559 (+)	NCBI

RefSeq Acc Id:

XM_063282220 ⟹ XP_063138290

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	223,777,876 - 223,812,582 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001107254	(Get FASTA)	NCBI Sequence Viewer
	XP_038958650	(Get FASTA)	NCBI Sequence Viewer
	XP_063138290	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58623	(Get FASTA)	NCBI Sequence Viewer
	B0BMZ3	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060170

RefSeq Acc Id:

NP_001107254 ⟸ NM_001113782

- UniProtKB:

B0BMZ3 (UniProtKB/Swiss-Prot), A0A8L2QUX3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMDANKMIINLAVLGKTQSGKSSAGNVLLGSADFYSRFAPGSVTKDCSLGRSCHIHGFMRRGGH
EISLQIQVLDTPGYPHSKLSTRCVKQEVKKALEHHFGQEGLHLALLVHRADMPFFGQEASDSVQ
LIQELLGDSWKNYTAILFTHAEKIKEAGLSEEEYLCEASDALLTLLNSVQHRHIFLYERGNSWS
EQRIKILERIMEFIKENHFQVLSFT

hide sequence

Ensembl Acc Id:

ENSRNOP00000060170 ⟸ ENSRNOT00000064628

RefSeq Acc Id:	XP_038958650 ⟸ XM_039102722
- Peptide Label:	isoform X1
- UniProtKB:	B0BMZ3 (UniProtKB/Swiss-Prot), A0A8L2QUX3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138290 ⟸ XM_063282220
- Peptide Label:	isoform X1
- UniProtKB:	B0BMZ3 (UniProtKB/Swiss-Prot), A0A8L2QUX3 (UniProtKB/TrEMBL)

Protein Domains

AIG1-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BMZ3-F1-model_v2	AlphaFold	B0BMZ3	1-216	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563706	AgrOrtholog
BioCyc Gene	G2FUF-51177	BioCyc
Ensembl Genes	ENSRNOG00000042721	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000064628	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7454123	IMAGE-MGC_LOAD
InterPro	G_AIG1	UniProtKB/Swiss-Prot
	GIMA/IAN/Toc	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:362042	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187525	IMAGE-MGC_LOAD
NCBI Gene	362042	ENTREZGENE
PANTHER	GTPASE IMAP FAMILY MEMBER GIMD1	UniProtKB/Swiss-Prot
	PTHR10903	UniProtKB/Swiss-Prot
Pfam	AIG1	UniProtKB/Swiss-Prot
PhenoGen	Gimd1	PhenoGen
PROSITE	G_AIG1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000042721	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8L2QUX3	ENTREZGENE, UniProtKB/TrEMBL
	B0BMZ3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-12	Gimd1	GIMAP family P-loop NTPase domain containing 1	RGD1563706	similar to Zgc:92184	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1563706	similar to Zgc:92184	RGD1563706_predicted	similar to Zgc:92184 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563706_predicted	similar to Zgc:92184 (predicted)	LOC362042	similar to Zgc:92184	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC362042	similar to Zgc:92184			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message