Mmp28 (matrix metallopeptidase 28)

Gene: Mmp28 (matrix metallopeptidase 28) Rattus norvegicus

Analyze

Symbol:

Mmp28

Name:

matrix metallopeptidase 28

RGD ID:

1311573

Description:

Predicted to enable metalloendopeptidase activity. Predicted to be involved in collagen catabolic process and extracellular matrix organization. Predicted to act upstream of or within negative regulation of macrophage chemotaxis. Predicted to be located in cytoplasm. Predicted to be active in extracellular space. Orthologous to human MMP28 (matrix metallopeptidase 28); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100912318; LOC103694864; LOC303384; matrix metallopeptidase 28 (epilysin); matrix metalloproteinase 28 (epilysin); matrix metalloproteinase-28; matrix metalloproteinase-28-like

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MMP28 (matrix metallopeptidase 28)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Mmp28 (matrix metallopeptidase 28 (epilysin))	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Mmp28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MMP28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MMP28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mmp28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MMP28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MMP28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mmp28 (matrix metallopeptidase 28)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MMP26 (matrix metallopeptidase 26)	HGNC	Treefam
Homo sapiens (human):	C17orf50 (chromosome 17 open reading frame 50)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	MMP28 (matrix metallopeptidase 28)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mmp28 (matrix metallopeptidase 28 (epilysin))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mmp28 (matrix metallopeptidase 28)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zmp-3	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	mmp28	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	68,738,651 - 68,762,377 (-)	NCBI		GRCr8
mRatBN7.2	10	68,241,138 - 68,264,866 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,241,138 - 68,264,866 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	72,863,750 - 72,884,732 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,369,134 - 72,390,115 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	67,833,186 - 67,854,165 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	70,660,691 - 70,681,672 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	70,660,691 - 70,681,672 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	71,122,715 - 71,143,696 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	71,526,718 - 71,547,699 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	71,541,276 - 71,562,259 (-)	NCBI
Celera	10	67,185,212 - 67,206,220 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Arterial Occlusive Diseases (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

amphotericin B (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cisplatin (ISO)

diarsenic trioxide (ISO)

ethanol (EXP)

fenvalerate (EXP)

fluoranthene (ISO)

gentamycin (EXP)

microcystin-LR (ISO)

monosodium L-glutamate (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (EXP,ISO)

pterostilbene (ISO)

simvastatin (ISO)

sodium fluoride (ISO)

sulforaphane (ISO)

testosterone (EXP)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

collagen catabolic process (IBA)

extracellular matrix organization (IBA)

negative regulation of macrophage chemotaxis (ISO)

proteolysis (IEA)

Cellular Component

cytoplasm (ISO)

extracellular matrix (IEA)

extracellular space (IBA)

Molecular Function

metalloendopeptidase activity (IBA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Assessment of gene expression profiles in peripheral occlusive arterial disease.	Bubenek S, etal., Can J Cardiol. 2012 Nov-Dec;28(6):712-20. doi: 10.1016/j.cjca.2012.03.013. Epub 2012 Jun 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17218081	PMID:19265166	PMID:27068509

Genomics

Comparative Map Data

Mmp28
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	68,738,651 - 68,762,377 (-)	NCBI		GRCr8
mRatBN7.2	10	68,241,138 - 68,264,866 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	68,241,138 - 68,264,866 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	72,863,750 - 72,884,732 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	72,369,134 - 72,390,115 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	67,833,186 - 67,854,165 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	70,660,691 - 70,681,672 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	70,660,691 - 70,681,672 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	71,122,715 - 71,143,696 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	71,526,718 - 71,547,699 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	71,541,276 - 71,562,259 (-)	NCBI
Celera	10	67,185,212 - 67,206,220 (-)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

MMP28
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	35,756,249 - 35,795,641 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	35,756,249 - 35,795,707 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	34,083,268 - 34,122,645 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	31,116,989 - 31,146,753 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	31,116,988 - 31,146,741	NCBI
Celera	17	31,003,010 - 31,032,922 (-)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	30,278,035 - 30,307,831 (-)	NCBI		HuRef
CHM1_1	17	34,157,411 - 34,187,192 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	36,704,182 - 36,743,551 (-)	NCBI		T2T-CHM13v2.0

Mmp28
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	83,331,594 - 83,353,890 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	83,331,594 - 83,353,897 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	83,440,768 - 83,463,040 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	83,440,768 - 83,463,071 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	83,255,378 - 83,276,463 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	83,258,071 - 83,279,156 (-)	NCBI		MGSCv36	mm8
Celera	11	93,036,503 - 93,057,585 (-)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	50.39	NCBI

Mmp28
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	10,207,704 - 10,232,816 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	10,207,704 - 10,242,666 (-)	NCBI	ChiLan1.0	ChiLan1.0

MMP28
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	28,681,345 - 28,710,941 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	30,560,619 - 30,590,184 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	20,999,658 - 21,039,476 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	21,293,767 - 21,333,684 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	21,293,767 - 21,323,691 (+)	Ensembl	panpan1.1		panPan2

MMP28
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	37,873,364 - 37,907,724 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	37,884,430 - 37,907,719 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	37,097,600 - 37,131,941 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	38,685,116 - 38,719,456 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	38,696,188 - 38,718,859 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	37,467,864 - 37,502,250 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	37,753,363 - 37,787,721 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	37,840,856 - 37,875,211 (+)	NCBI		UU_Cfam_GSD_1.0

Mmp28
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	36,886,239 - 36,909,510 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	165,376 - 188,823 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	165,462 - 188,788 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MMP28
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	39,739,630 - 39,766,791 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	39,739,074 - 39,766,794 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MMP28
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	29,241,938 - 29,272,231 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	29,240,569 - 29,272,077 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	702,510 - 732,930 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mmp28
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624875	3,243,147 - 3,266,558 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624875	3,240,386 - 3,266,811 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mmp28
95 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	214
Count of miRNA genes:	120
Interacting mature miRNAs:	130
Transcripts:	ENSRNOT00000013836, ENSRNOT00000064937
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	65927233	82565079	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	66941813	73452992	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67502108	73579767	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642290	Bp299	Blood pressure QTL 299			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68230134	69282520	Rat

Markers in Region

RH138810

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	68,248,308 - 68,248,429 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	70,665,250 - 70,665,370	NCBI	Rnor6.0
Rnor_5.0	10	71,127,274 - 71,127,394	UniSTS	Rnor5.0
Rnor_5.0	10	70,298,289 - 70,298,409	UniSTS	Rnor5.0
RGSC_v3.4	10	71,531,277 - 71,531,397	UniSTS	RGSC3.4
Celera	10	67,189,771 - 67,189,891	UniSTS
Cytogenetic Map	10	q26	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001079888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF121988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF121989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000013836 ⟹ ENSRNOP00000013836

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	68,241,138 - 68,264,866 (-)	Ensembl
Rnor_6.0 Ensembl	10	70,660,691 - 70,681,672 (-)	Ensembl

RefSeq Acc Id:

NM_001079888 ⟹ NP_001073357

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	68,738,651 - 68,762,377 (-)	NCBI
mRatBN7.2	10	68,241,138 - 68,264,866 (-)	NCBI
Rnor_6.0	10	70,660,691 - 70,681,672 (-)	NCBI
Rnor_5.0	10	71,122,715 - 71,143,696 (-)	NCBI
RGSC_v3.4	10	71,526,718 - 71,547,699 (-)	RGD
Celera	10	67,185,212 - 67,206,220 (-)	RGD

Sequence:

show sequence

ATGGTGACTGGCTTGAGCCTCCTGCTGCGCGTCCTGCCGCTACTGCTGTGGGGCTGCCAGGACG
CACAGCCCACCCCGCGCGGACACCCGGAGCTACACCAGGAGGCAGAGGCATTCCTGGAGAAGTA
TGGATACCTCAGTGAGCAGGGTTCCAAAGTTCCAGCCTCCACTCAGTTCAGTGACGCCATCCGA
GAGTTCCAGTGGGTATCCCAGCTGCCCATCAGCGGTGTGCTGGACCGGGCCACACTGCGTCAGA
TGACACGCCCACGCTGTGGGGTCGCAGATACCGACAGTCACGAAACTTGGACAGAGAGGATCCG
TGCCCTGCTTGCTGGACACCGCGCCAAAATGAGGCGTAAGAAACGCTTTGCAAAGCCAGGTCAC
AAATGGTACAAGCAGCATCTTTCCTACCGCCTGGTGAACTGGCCCAAGAGCCTGCCTGAGCCAG
CTGTGCGAGGGGCTGTCCGTGCCGCCTTCCAGCTATGGAGTAATGTGTCAGCGCTGGAGTTCTG
GGAGGCCCCAGCCACAGGCCCTGCTGACATCCGCCTCACCTTCTTCCAAGGAGACCACAATGAT
GGGCTGGCCAACGCCTTCGATGGCCCAGGGGGCGCCCTGGCGCACGCCTTCCTGCCCCGCCGAG
GCGAAGCGCATTTCGACCAAGACGAGCGTTGGTCTCTGAGTCGCCGCCGTGGGCGCAACCTGTT
CGTGGTGCTGGCTCACGAGATCGGCCACACGCTCGGTCTCACGCACTCGCCCGCGCCACGTGCG
CTCATGGCGCCCTACTACAAGAAGCTGGGCCGTGACGCCTTGCTCAGCTGGGACGATGTGCTGG
CGGTGCAGAACCTGTACGGAAAGCCCCTAGGACGCTCAGTAGCCACCCAACTCCCTGGAAAGAT
ATTCACTGACTTTGAAGCCTGGGACCCCCACAACTCTCAGAGCAGACGCCCGGAAACCAGAGGA
CCTAAATACTGCCACTCTTCCTTTGATGCCATCACTGTAGATGGGCAATGGCGACTGTACGTCT
TCAAAGGGAGCCACTTCTGGGAAGTCACAGCTGATGGCAATGTTTCAGAGCCTCATCCACTACA
GAAAAGATGGCCGGGACTGCCCTCTAGTATTGAGGCTGCTGCAGTGTCTCTGGAAGATGGAGAC
TTCTTCTTCTTCAAAGGGAATCGCTGTTGGAGGTTCCAAGGCACGAAGTCCGTGTTCGCACAGC
TCTGCCGGGCAGGTGGTCTGCCCCGACACCCAGACGCAGCTCTCTTCTTCCCGCCTCTGCGCCG
CCTAGTCCTCTTCAAGGGTTCCCGCTACTACGTGCTGGCTCGAGGAGGGATGCAAGTGGAGCCC
TACTATCCCCGCAGTCTGAGGGACTGGGCTGGGGTCCCTGAGGAGGTCAGCGGCGCCTTGCCAA
GGCCGGACGGTTCCATTATCTTCTTTAGAGATGACCACTATTGGCACTTGGATCAAGCCAAACT
GCGGGTGACCAGCTCTGGCCGCTGGGCCACCGAGCTGTCCTGGATGGGCTGTTGGAATGCCAAC
TCAGGAGGTGCCCTGTTCCAAAGGCTCCCCGTCACTGAATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001073357	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABL63427	(Get FASTA)	NCBI Sequence Viewer
	ABL63428	(Get FASTA)	NCBI Sequence Viewer
	EDM05485	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013836
	ENSRNOP00000013836.4

RefSeq Acc Id:	NP_001073357 ⟸ NM_001079888
- Peptide Label:	precursor
- UniProtKB:	A1EC81 (UniProtKB/TrEMBL), D3ZNN5 (UniProtKB/TrEMBL), A1EC82 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVTGLSLLLRVLPLLLWGCQDAQPTPRGHPELHQEAEAFLEKYGYLSEQGSKVPASTQFSDAIR EFQWVSQLPISGVLDRATLRQMTRPRCGVADTDSHETWTERIRALLAGHRAKMRRKKRFAKPGH KWYKQHLSYRLVNWPKSLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHND GLANAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRA LMAPYYKKLGRDALLSWDDVLAVQNLYGKPLGRSVATQLPGKIFTDFEAWDPHNSQSRRPETRG PKYCHSSFDAITVDGQWRLYVFKGSHFWEVTADGNVSEPHPLQKRWPGLPSSIEAAAVSLEDGD FFFFKGNRCWRFQGTKSVFAQLCRAGGLPRHPDAALFFPPLRRLVLFKGSRYYVLARGGMQVEP YYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDHYWHLDQAKLRVTSSGRWATELSWMGCWNAN SGGALFQRLPVTE hide sequence

RefSeq Acc Id:

ENSRNOP00000013836 ⟸ ENSRNOT00000013836

Protein Domains

Peptidase metallopeptidase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1EC81-F1-model_v2	AlphaFold	A1EC81	1-525	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311573	AgrOrtholog
BioCyc Gene	G2FUF-23886	BioCyc
Ensembl Genes	ENSRNOG00000047940	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013836	ENTREZGENE
	ENSRNOT00000013836.5	UniProtKB/TrEMBL
Gene3D-CATH	2.110.10.10	UniProtKB/TrEMBL
	3.40.390.10	UniProtKB/TrEMBL
InterPro	Hemopexin-like_dom_sf	UniProtKB/TrEMBL
	Hemopexin/matrixin	UniProtKB/TrEMBL
	Hemopexin/matrixin_repeat	UniProtKB/TrEMBL
	M10A_MMP	UniProtKB/TrEMBL
	MetalloPept_cat_dom	UniProtKB/TrEMBL
	Pept_M10_metallopeptidase	UniProtKB/TrEMBL
	Pept_M10A_matrixin	UniProtKB/TrEMBL
	Peptidase_Metallo	UniProtKB/TrEMBL
	Peptidoglycan-bd-like	UniProtKB/TrEMBL
	PGBD-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:303384	UniProtKB/TrEMBL
NCBI Gene	303384	ENTREZGENE
PANTHER	MATRIX METALLOPROTEINASE	UniProtKB/TrEMBL
	MATRIX METALLOPROTEINASE-28	UniProtKB/TrEMBL
Pfam	Hemopexin	UniProtKB/TrEMBL
	Peptidase_M10	UniProtKB/TrEMBL
	PG_binding_1	UniProtKB/TrEMBL
PhenoGen	Mmp28	PhenoGen
PIRSF	Peptidase_M10A_matrix	UniProtKB/TrEMBL
PRINTS	MATRIXIN	UniProtKB/TrEMBL
PROSITE	HEMOPEXIN_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000047940	RatGTEx
SMART	SM00120	UniProtKB/TrEMBL
	ZnMc	UniProtKB/TrEMBL
Superfamily-SCOP	Hemopexin	UniProtKB/TrEMBL
	Metalloproteases ('zincins'), catalytic domain	UniProtKB/TrEMBL
	PGBD_like	UniProtKB/TrEMBL
UniProt	A1EC81	ENTREZGENE, UniProtKB/TrEMBL
	A1EC82	ENTREZGENE, UniProtKB/TrEMBL
	D3ZNN5	ENTREZGENE
UniProt Secondary	D3ZNN5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Mmp28	matrix metallopeptidase 28	LOC103694864	matrix metalloproteinase-28-like	Data merged from RGD:9149208	737654	PROVISIONAL
2015-07-29	LOC103694864	matrix metalloproteinase-28-like	LOC100912318	matrix metalloproteinase-28-like	Data merged from RGD:6487746	737654	PROVISIONAL
2014-08-25	LOC103694864	matrix metalloproteinase-28-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-07-05	LOC100912318	matrix metalloproteinase-28-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-04-23	Mmp28	matrix metallopeptidase 28	Mmp28	matrix metallopeptidase 28 (epilysin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Mmp28	matrix metallopeptidase 28 (epilysin)	Mmp28_predicted	matrix metallopeptidase 28 (epilysin) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Mmp28_predicted	matrix metallopeptidase 28 (epilysin) (predicted)		matrix metalloproteinase 28 (epilysin) (predicted)	Name updated	1299863	APPROVED
2005-01-12	Mmp28_predicted	matrix metalloproteinase 28 (epilysin) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar