Advanced Search (OLGA)

Gene: Slc35a3 (solute carrier family 35 member A3) Rattus norvegicus

Analyze

Symbol:

Slc35a3 (Ensembl: Mfsd14a)

Name:

solute carrier family 35 member A3 (Ensembl:major facilitator superfamily domain containing 14A)

RGD ID:

1308615

Description:

Predicted to enable UDP-galactose transmembrane transporter activity. Predicted to be involved in UDP-N-acetylglucosamine transmembrane transport. Predicted to be located in Golgi apparatus. Predicted to be active in Golgi membrane. Orthologous to human SLC35A3 (solute carrier family 35 member A3); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

golgi UDP-GlcNAc transporter; LOC310808; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3; UDP-N-acetylglucosamine transporter

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	207,305,008 - 207,344,225 (-)	NCBI		GRCr8
mRatBN7.2	2	204,620,103 - 204,659,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	204,579,174 - 204,659,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	212,278,283 - 212,314,620 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	210,189,105 - 210,225,456 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	205,006,179 - 205,042,534 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	219,705,618 - 219,741,886 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	219,705,620 - 219,741,886 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	237,476,502 - 237,513,171 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	212,902,953 - 212,939,222 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	212,865,708 - 212,901,976 (-)	NCBI
Celera	2	197,114,778 - 197,151,034 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

arthrogryposis multiplex congenita (ISO)

Arthrogryposis, Impaired Intellectual Development, and Seizures (ISO)

genetic disease (ISO)

glycogen storage disease III (ISO)

maple syrup urine disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin M1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (EXP,ISO)

arsenite(3-) (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

butanal (ISO)

captan (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crotonaldehyde (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

epoxiconazole (ISO)

folic acid (ISO)

folpet (ISO)

fulvestrant (ISO)

gallic acid (ISO)

L-methionine (ISO)

methidathion (ISO)

methimazole (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

pyrimidine nucleotide-sugar transmembrane transport (IEA)

UDP-galactose transmembrane import into Golgi lumen (IBA)

UDP-N-acetylglucosamine transmembrane transport (ISO,ISS)

Cellular Component

Golgi apparatus (ISO)

Golgi membrane (IBA,IEA,ISO,ISS)

Molecular Function

antiporter activity (IEA)

protein binding (ISO)

pyrimidine nucleotide-sugar transmembrane transporter activity (IEA)

UDP-galactose transmembrane transporter activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:21918738	PMID:23089177

Genomics

Comparative Map Data

Slc35a3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	207,305,008 - 207,344,225 (-)	NCBI		GRCr8
mRatBN7.2	2	204,620,103 - 204,659,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	204,579,174 - 204,659,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	212,278,283 - 212,314,620 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	210,189,105 - 210,225,456 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	205,006,179 - 205,042,534 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	219,705,618 - 219,741,886 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	219,705,620 - 219,741,886 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	237,476,502 - 237,513,171 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	212,902,953 - 212,939,222 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	212,865,708 - 212,901,976 (-)	NCBI
Celera	2	197,114,778 - 197,151,034 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

SLC35A3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	99,969,996 - 100,035,634 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	99,969,351 - 100,035,634 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	100,435,552 - 100,501,190 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	100,208,128 - 100,261,594 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	100,147,560 - 100,201,027	NCBI
Celera	1	98,691,115 - 98,744,765 (+)	NCBI		Celera
Cytogenetic Map	1	p21.2	NCBI
HuRef	1	98,557,764 - 98,615,255 (+)	NCBI		HuRef
CHM1_1	1	100,551,698 - 100,608,854 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	99,818,116 - 99,883,750 (+)	NCBI		T2T-CHM13v2.0

Slc35a3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	116,463,118 - 116,506,366 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	116,463,119 - 116,506,480 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	116,669,469 - 116,712,708 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	116,669,470 - 116,712,831 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	116,373,716 - 116,415,198 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	116,662,802 - 116,704,284 (-)	NCBI		MGSCv36	mm8
Celera	3	123,097,873 - 123,139,255 (-)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	50.44	NCBI

Slc35a3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	4,720,633 - 4,774,809 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	4,747,981 - 4,774,250 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLC35A3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	126,987,780 - 127,064,633 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	126,157,471 - 126,215,367 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	102,625,605 - 102,701,687 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	101,344,831 - 101,412,372 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

SLC35A3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	49,954,148 - 49,976,260 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	49,950,821 - 49,976,260 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	52,627,204 - 52,678,542 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	50,300,428 - 50,355,335 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	50,300,518 - 50,355,142 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	49,995,603 - 50,047,097 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	49,974,502 - 50,026,207 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	50,406,295 - 50,457,631 (-)	NCBI		UU_Cfam_GSD_1.0

Slc35a3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	110,353,165 - 110,395,580 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936748	157,935 - 201,119 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936748	158,290 - 200,458 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC35A3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	118,103,006 - 118,153,159 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	118,102,800 - 118,153,144 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	129,697,181 - 129,744,254 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC35A3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	33,302,390 - 33,368,833 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	33,318,200 - 33,368,635 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	24,687,082 - 24,754,627 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc35a3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624857	2,799,617 - 2,819,965 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624857	2,781,472 - 2,819,963 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc35a3
190 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	447
Count of miRNA genes:	240
Interacting mature miRNAs:	294
Transcripts:	ENSRNOT00000021676
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Markers in Region

DXGot12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	204,635,903 - 204,636,081 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	219,718,480 - 219,718,655	NCBI	Rnor6.0
Rnor_5.0	2	237,499,744 - 237,499,919	UniSTS	Rnor5.0
RGSC_v3.4	2	212,915,815 - 212,915,991	RGD	RGSC3.4
RGSC_v3.4	2	212,915,816 - 212,915,991	UniSTS	RGSC3.4
RGSC_v3.1	2	212,878,570 - 212,878,745	RGD
Celera	2	197,127,604 - 197,127,813	UniSTS
RH 3.4 Map	X	213.33	UniSTS
RH 3.4 Map	X	213.33	RGD
RH 2.0 Map	21	200.7	RGD
Cytogenetic Map	2	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020907 ⟹ ENSRNOP00000020907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	204,579,174 - 204,611,628 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075340 ⟹ ENSRNOP00000064285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	204,579,174 - 204,659,319 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085122 ⟹ ENSRNOP00000074264

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	204,623,042 - 204,659,319 (-)	Ensembl
Rnor_6.0 Ensembl	2	219,705,620 - 219,741,886 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088123 ⟹ ENSRNOP00000075642

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	204,579,174 - 204,611,482 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097342 ⟹ ENSRNOP00000086799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	204,623,042 - 204,658,828 (-)	Ensembl

RefSeq Acc Id:

NM_001012082 ⟹ NP_001012082

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,307,945 - 207,344,217 (-)	NCBI
mRatBN7.2	2	204,623,040 - 204,659,319 (-)	NCBI
Rnor_6.0	2	219,705,618 - 219,741,886 (-)	NCBI
Rnor_5.0	2	237,476,502 - 237,513,171 (+)	NCBI
RGSC_v3.4	2	212,902,953 - 212,939,222 (-)	RGD
Celera	2	197,114,778 - 197,151,034 (-)	RGD

Sequence:

show sequence

CCGCGGGAGCCGGCAGCGCTGCGGGTCAGCGGGCGCGGCGGAGCCGGCGGGCTCAGCAGCCTGG
GTCGCCCGGCGTCGCGGAGCCTGGAGCTCCAGTGCGGGCAGCTGGCCGAGCCGCACGGCGGACA
AATGAAGAGAAAACAATGTCTGCCAACCTAAAATATCTTTCCTTGGGAATTTTGGTGTTTCAGA
CTACCAGTCTGGTTCTAACGATGCGTTATTCTAGGACTTTAAAAGAGGAGGGACCTCGTTATCT
GTCTTCTACAGCAGTGGTTGTGGCTGAATTTTTGAAGATAATGGCCTGCATCTTTTTAGTCTAC
AAAGACAGTAAGTGTAGTGTGAGAACACTGAATAGAGTACTGCATGATGAAATTCTTAATAAAC
CCATGGAAACACTGAAGCTTGCTATTCCATCAGGGATATATACTCTTCAGAACAACTTACTCTA
TGTGGCACTGTCAAACCTGGATGCAGCCACTTACCAGGTTACATATCAGTTGAAAATACTTACA
ACAGCATTGTTTTCTGTGTCTATGCTGGGTAAAAAACTAGGCATGTACCAGTGGCTCTCCCTAG
TGATTCTGATGGCAGGAGTTGCTTTTGTACAGTGGCCTTCAGATTCTCAAGAGCTGAATTCTAA
GGACCTTTCAACTGGCTCACAGTTTGTGGGCCTCATGGCAGTTCTCATAGCCTGTTTTTCAAGT
GGCTTCGCCGGAGTTTATTTTGAGAAAATCTTAAAAGAAACAAAACAATCAGTATGGATAAGAA
ACATTCAACTTGGTTTCTTTGGGAGTATATTTGGATTAATGGGTGTGTACGTTTATGATGGAGA
ATTGGTATCAAAGAATGGATTTTTTCAAGGATATAATCAACTGACATGGATAGTTGTTGTTCTA
CAGGCACTTGGAGGCCTTGTAATAGCTGCTGTCATCAAATATGCAGATAACATTTTAAAAGGAT
TCGCGACCTCCTTATCCATAATATTGTCAACAATCATATCTTATTTTTGGTTGCAAGATTTTGT
GCCAACCAGTGTCTTTTTCCTTGGAGCCATCCTTGTCATAGCAGCTACTTTCTTGTACGGTTAT
GATCCCAAACCTGCAGGAAATCCCACTAAAGCATAGTCATGTCCTATCCCTAATTGGATTTCAC
AATGGTGCCCTAGGAGCCTCAACATTAATCTTGCCCAGAGGACTTCTGCAGATTCTATGAAGAA
ATCATCATGCTAAATCTGATCACTCTGTTGAGATGGTTTGAAAATGTGTAGCCTTCAGGATGAA
ATGTGTATATCATCTGCAACCCAAGCTTGGAAGTGTGTCCAGGAAGTCGGGTTAGAGGGGATAC
TGGGAGGAGGCCTTAAGTCTGAGCTCGTAATGACCTCAGCCCTTTAGTTGCTGCAGAACGGTCC
ATTGCAGCCTTTGCAAGAGCACACACATGCAAATAAATACCAAGGTTTGCAAGGTAGATCTGCC
TACACTTATCACCTGTTCTTAACCTTACTCTTTCTGTACAGAGATATCAAGTTACATGAACTAT
TTAAAATGGAAATTTATAATCATCTATAAAGCTGTGAACAATTATAATTTAAAACCATTTTCAT
GTATCTGGGATTTTTATATTTATACAGAAGATTACTAAAGAAAGGATTGGTAAATTTTATTTGT
TTAATTCCATAAGACTTGATGAAGTAGTAATCTGGGTTTGAATCATTTAAATTTAATGTAGAAA
GAGTCTATCCCTCTATGTGTGTCTTTTGACCATTTACTACTTTGGCTGAAGCAGTTTGGTTCTT
TCTACGCTAGAGTAGTCAGTGACTGGCTCTAATGAGGTTTACCATCATTTCCCAGTTGTGCTTC
TTTTCTCATTATTCTCATTATTATCTTAAATTGAATCTGTGTGTGTGTTGCCATTAAAACTTTT
AAATGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063281941 ⟹ XP_063138011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,305,008 - 207,344,225 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001012082	(Get FASTA)	NCBI Sequence Viewer
	XP_063138011	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79371	(Get FASTA)	NCBI Sequence Viewer
	EDL82044	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064285.2
	ENSRNOP00000074264.1
	ENSRNOP00000086799.1
	ENSRNOP00055001418
	ENSRNOP00060000589
	ENSRNOP00065030954
GenBank Protein	Q6AXR5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001012082 ⟸ NM_001012082

- UniProtKB:

Q6AXR5 (UniProtKB/Swiss-Prot), A6HVA8 (UniProtKB/TrEMBL), A0A8I6A4I5 (UniProtKB/TrEMBL), A6HVA6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKC
SVRTLNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFS
VSMLGKKLGMYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLIACFSSGFAGV
YFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVVLQALGG
LVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPA
GNPTKA

hide sequence

Ensembl Acc Id:

ENSRNOP00000074264 ⟸ ENSRNOT00000085122

Ensembl Acc Id:

ENSRNOP00000064285 ⟸ ENSRNOT00000075340

Ensembl Acc Id:

ENSRNOP00000075642 ⟸ ENSRNOT00000088123

Ensembl Acc Id:

ENSRNOP00000086799 ⟸ ENSRNOT00000097342

Ensembl Acc Id:

ENSRNOP00000020907 ⟸ ENSRNOT00000020907

RefSeq Acc Id:	XP_063138011 ⟸ XM_063281941
- Peptide Label:	isoform X1

Protein Domains

Major facilitator superfamily (MFS) profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXR5-F1-model_v2	AlphaFold	Q6AXR5	1-326	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691710

Promoter ID:

EPDNEW_R2235

Type:

initiation region

Name:

Slc35a3_1

Description:

solute carrier family 35 member A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	219,741,891 - 219,741,951	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308615	AgrOrtholog
BioCyc Gene	G2FUF-51489	BioCyc
Ensembl Genes	ENSRNOG00000015502	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00000061832	Ensembl
	ENSRNOG00055001101	UniProtKB/Swiss-Prot
	ENSRNOG00060000992	UniProtKB/Swiss-Prot
	ENSRNOG00065022405	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000075340.3	UniProtKB/TrEMBL
	ENSRNOT00000085122.2	UniProtKB/Swiss-Prot
	ENSRNOT00000097342.1	UniProtKB/TrEMBL
	ENSRNOT00055001818	UniProtKB/Swiss-Prot
	ENSRNOT00060001324	UniProtKB/Swiss-Prot
	ENSRNOT00065038236	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109915	IMAGE-MGC_LOAD
InterPro	MFS	UniProtKB/TrEMBL
	MFS_dom	UniProtKB/TrEMBL
	MFS_trans_sf	UniProtKB/TrEMBL
	Nuc_sug_transpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sugar_transporter_CS	UniProtKB/TrEMBL
	Tet-R_TetA/multi-R_MdtG	UniProtKB/TrEMBL
KEGG Report	rno:310808	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94859	IMAGE-MGC_LOAD
NCBI Gene	310808	ENTREZGENE
PANTHER	PTHR10231	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP-N-ACETYLGLUCOSAMINE TRANSPORTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MFS_1	UniProtKB/TrEMBL
	Nuc_sug_transp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc35a3	PhenoGen
PIRSF	UDP-gal_transpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	TCRTETA	UniProtKB/TrEMBL
PROSITE	MFS	UniProtKB/TrEMBL
	SUGAR_TRANSPORT_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015502	RatGTEx
	ENSRNOG00000061832	RatGTEx
	ENSRNOG00055001101	RatGTEx
	ENSRNOG00060000992	RatGTEx
	ENSRNOG00065022405	RatGTEx
Superfamily-SCOP	MFS general substrate transporter	UniProtKB/TrEMBL
	Multidrug resistance efflux transporter EmrE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A4I5	ENTREZGENE, UniProtKB/TrEMBL
	A6HVA6	ENTREZGENE, UniProtKB/TrEMBL
	A6HVA8	ENTREZGENE, UniProtKB/TrEMBL
	M0R4J8_RAT	UniProtKB/TrEMBL
	Q6AXR5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Slc35a3	solute carrier family 35 member A3	Slc35a3	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-20	Slc35a3	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3	Slc35a3	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-24	Slc35a3	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3	Slc35a3_predicted	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 (predicted)	Symbol and Name updated	1331545	APPROVED
2005-01-12	Slc35a3_predicted	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM